CAZyme Information: I303_02640-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02640-t42_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: cytoplasmic protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		95729.55	5.8519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:622624-625733(+)

Full Sequence      

MAPPPTHSHVTGNPVPEYYIHSDTLNFRDTKGRSLILRGVNLSGSAKNPNGQPSHIRQQF
WESVEAGEGDFSNRPLNLEDGSADIHLARLRAWGYNMLRYVFTWESLEHAGPGKYNYEFM
DYIIRVVRKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTLYACGIDPYGLTPTASAYIHC
EWPDAENPKPQEFPAMIWGTNYTRLANQTIWTLFFAGKTFAPKCIIDGKNIQDYLQDHFI
DAVGTLAKKIQDEAADLLDECIIGWDSVNEPGEGFIGHHDLTKIPDEQQLKKGPSPTPLE
GMKLGMGQALEIQIWNFGAMGPYRGGHQLIDPKGKKLWLSKEDDELRGGGKWGWKRGESW
EMGKCIWAQHGVWNPSTGELLKPDYFSTLPSDPTHEVDYVADFWSLHWLAYSSKIRLHHP
ESIHFIQAPVMKQPPKLPKSFLGGRACSSPHFYDGLTLMTKHWNWFNADAIGVIRKKYWS
IVQAVRVGEANIRNMMQGELSVLKQDTVDVLGNFPTLIGEIGIPYDMDGKKAYGYVDGGR
GEGDYSSQQRAMDCSMNACDGTNCLNYTIWNYVPDHCHEWSDNWNGEDLSLWSRDDIPRN
TYTDEGKASPNPSLAVPPTVSAATSSATLAASRSATPKLPFTPESIVAGDVPPSLILDGS
RAVAAFCRPFPIKTVGIPDRMDFDISSTEFKYTVYVNSSDVSSREVATEIFVPYVHYAAD
LGVGKSYGTSKGEYDGSRFSSRNTSRVDLINGNADEISKKASNNTDQTIRSVATTFEETT
LELDIDVKLSHGTYEITGQKLIWYYDVPSTGEAKYEIQIKRNGGALRRDIGYVQQGSWFD
VLKEIQRLSGGMGLTA

Enzyme Prediction     

EC	3.2.1.21:3	3.2.1.45:1	3.2.1.104:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	578	5.5e-212	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	2.66e-10	668	717	1	48	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	1.52e-04	48	144	2	88	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45117.1|GH5_12	0.0	1	844	1	847
ADV25373.1|GH5_12	0.0	1	844	1	847
AFR99035.1|GH5_12|3.2.1.104	0.0	1	844	1	847
AUB29264.1|GH5_12	0.0	1	844	1	847
KGB78428.2|GH5_12	0.0	1	841	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	0.0	1	844	2	793	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	1.18e-10	28	165	38	161	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	1.18e-10	28	165	38	161	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSY_A	1.18e-10	28	165	38	161	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE13|EGCR1_ASPFM	2.63e-187	23	717	9	686	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	1.20e-145	27	728	13	714	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	4.00e-93	27	717	22	628	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	1.91e-64	26	713	22	635	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_02640-t42_1-p1.