CAZyme Information: I303_02625-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02625-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	KI894029|CGC2	46595.18	6.1909

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:581023-582914(-)

Full Sequence      

MAISNKPDYATPMFDYRSYEVKEENVDELVARITKALVELEDKAGIHKYTIADGRVIDST
SWNFWEWQQAIGLYGLFNYYNLKSTENPSSPEAARTLKIIKEWYTARAAEGGTTKNINSM
AVLLTLASLMEVEYQRGGIFSAEEKKLYEGWIDEWAEWAFHDCPRTEQGIHQHITFRLEN
KNQVWDDTLMMTVLPLAKIGKLLNRPHYIEEAKYQFVQHAQYLMDPTNGLWNHGYEFDGK
GGGHEWGHIAWARGNCWITIAIPIFLDLIQLPKTDTVYRTLVSVLHRQVDTLVKLQDAET
GLWRTLLLDETSYVESSASAGFVAGMFIGIRTGLLEEQKYIKTALTGLRACIAQVKPNGE
VQNVSKGTPVSTDPNFYKDMPKMTVGFGQSLPIMALGEWLRYEKAKAKK

Enzyme Prediction     

No EC number prediction in I303_02625-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	401	1.5e-85	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.43e-76	65	401	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.82e-72	39	402	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX50406.1|GH105	1.70e-113	30	401	20	378
QET66872.1|GH105	4.15e-111	11	401	9	376
AYN26454.1|GH105	4.15e-111	11	401	9	376
UNK63307.1|GH105	4.15e-111	11	401	9	376
AKK79789.1|GH105	5.88e-111	29	401	27	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.05e-104	11	401	11	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.14e-101	29	401	30	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.42e-101	33	401	15	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	2.93e-13	181	381	196	391	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.23e-39	65	404	29	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_02625-t42_1-p1.