CAZyme Information: I303_02622-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02622-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KI894029|CGC11	50271.11	6.0499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:575323-576920(+)

Full Sequence      

MVRSLRLVSCCIPLIVIFWIALRWQLKSDRSSVIWYTAQTDLSVHTYRHESHDLINITWL
FEVANPDPIIQSLIRASFSHNLYEAKVIPFYRKKKDTFTSEQITLLTFITGDRLGRLVAL
AERRRAPISVAFYVPPDDETATQQLFHLDKLLHDHPVIAWNVDIHLVTSPYLLQLNTWRT
VARTFATTDWVLLWDVDFEPCTDYQKGLEKFLRNTRDKGWATRLERGEAALVIPPFEWVD
LEVANSRRDVCPSSKSELASLYHDLTLDAFETLNPVLSHATDYAHLLVAGETDYYEIKEY
ELGYEVYPIFRRDAPVWFDQRFVGYGFERSAITAQMYLSGMDLYVLPGEYAFHVEHSRSS
STHRDDIKSVQISWTTFRMDLCHTLGLRLAHKGELHTSAGERLVSACQSTGIDDIDLDIK
RSLWLSGKTSWADSD

Enzyme Prediction     

No EC number prediction in I303_02622-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	96	366	6.1e-30	0.7596439169139466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.60e-24	103	353	2	290	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06289.1|GT49	7.07e-51	25	415	43	420
CCA70499.1|GT49	1.48e-49	64	422	80	435
CDS06217.1|GT49	3.47e-49	39	408	60	422
CDS10115.1|GT49	2.42e-46	57	407	75	416
CDR39118.1|GT49	1.44e-45	71	382	206	513

PDB Hits     

I303_02622-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54PG8|GNT14_DICDI	2.75e-18	102	359	347	587	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q66PG1|LARG2_DANRE	5.52e-17	103	359	468	705	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q8N3Y3|LARG2_HUMAN	9.55e-17	103	371	432	690	Xylosyl- and glucuronyltransferase LARGE2 OS=Homo sapiens OX=9606 GN=LARGE2 PE=1 SV=2
sp|O95461|LARG1_HUMAN	2.33e-16	100	359	471	711	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q66PG4|LARG2_CHICK	3.06e-16	103	359	457	694	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995924	0.004093

TMHMM  Annotations     

Start	End
5	22