CAZyme Information: I303_02616-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02616-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	KI894029|CGC7	94143.42	6.0058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:559316-562774(-)

Full Sequence      

MTKAAVIDPEAVLKELSSEEKIALLSGDDMWHTVPIPRLGVPRVRNGVRGTAWTNGAPAS
CFPSATGLGASMDVELARRIGEALGEECRARGVHCLLGPTTNCQRHPCGGRGFESFSEDP
YLCGHVALAWVEGVQSKKVMTSPKHFLANEQEYLRRSNNSVIDERTMHEIYLEPFRIQAK
ARPSVFMSSYNRVNGLHVAEHPFLLRKVLREDFEFKGMIMSDWSGTYSSSEAVKASLDLE
MPGPALMRGSSLERDIIGGKLVPADIDECVLRVLHYVREAQQSGIDFEKEEDTINTPEIR
ALLREAADSAVVLLKNEQGVLPISDTVGSSKKTIAVIGPNAKTAAYAGGGSANLAPTYLV
TPFQAITEHADSIGAKVEYTIGSDASRWTPLLTPFIHHHQKTPADGPGVQCDFYDTNPWE
QGQGQKALKPKPLFSKFNNSAFSYFIDGIPKEIPVRGYVSLKTVFVPDESGIWELGLGVA
GQADLYIDGKKIIDNSTDQKEGLLFFNTGAEERTGEYEVQAGRSYDIEVRFSNFKQLNAM
SPYTGRRGGIRIGGRKKRDPKEEIEKAVKLASELDVAIVCIGTNSEYESEAYDREDMKLP
PGTDELVEAILAVRPDAIIVNQSGMPVEFPWIKNASTVVQAFFGGNECGRGISDILFGKV
NPSGKLPISWAEKVEDYPSHQDFGHPIDTVYSEGINTGYRYFDRNDNPKSAFPFGHGLSY
TSFKFSDLSVKPEGFGAKVNFTINNTGKVAGSEVAQIYIHDLSPIVEKPEHELGGLKKVF
LQPGESKQVSVNLDHKAFSFYSVQEKSWIGRKGDYEVRIGSSSTKIHLSKPVHLDNSFKW
IGLQEPQIYNVSWL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	242	5.6e-58	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.31e-69	62	827	120	758	beta-glucosidase BglX.
224389	BglX	2.57e-57	29	342	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.04e-47	311	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.39e-34	11	806	55	756	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.12e-30	62	274	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR98487.2|GH3	0.0	1	854	1	849
AUB28642.1|GH3	0.0	1	854	1	849
KNX49905.2|GH3	0.0	1	854	1	849
ADV25102.1|GH3	0.0	1	853	1	844
UOH85351.1|GH3	0.0	1	847	1	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.56e-193	8	843	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.54e-188	8	843	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.18e-130	7	839	3	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.38e-99	13	845	9	674	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.19e-85	36	834	87	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	5.53e-211	7	843	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.50e-209	7	843	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	7.04e-207	10	843	15	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	1.98e-206	10	843	15	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	5.42e-206	10	843	15	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999212	0.000810

TMHMM  Annotations     

There is no transmembrane helices in I303_02616-t42_1-p1.