CAZyme Information: I303_02120-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02120-t42_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976	KI894028|CGC1	110624.78	4.7971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894028:1791550-1795153(-)

Full Sequence      

MSFLRRMSSAASSFIPSIPNAQGIPASHVPRRPTETFSRTSKAFVEEEDIDEKASRASWE
LSDNESISSKGSRSSKSGASFATSDSGDIDKKSFDESDDSSSDESDDSILDRGGRPRDRY
DMMVRHLWNVAERQGWFRDAEFDGLVSIRVKKRVLRTYPQPKNTKKGARELGRRIKEWDA
AISTLNPEVAMKITSKVVQAIMARCAEDAIEITLDVNTRIQILDDLSQLAGARKHQFAAF
VRADACLVVWADEVETLIPSAEALEQRMIAYVWSGRHHELKLLEPESESEDEIDEKGEDE
EGWVDRDAEKEKELADADGDLTEEKVGGKEGDWEMRDRRPVMLYAPLVSGLAMILTFVFI
GSGIRNLIKEVLLDGSMARMALIATSPFGYLLSIFFSICVMGNLWQIFGPVAQCHQNSSY
FSGKAPKRMTGRLPHITIQMPVYKEGLEGVIIPTVESLKKAITTYERQGGSVNIFVFDDG
MQIWDEEEQEIRKAYYDRNNIGWTARPKHGKDGFIRKGRFKKASNMNFGNNLSLRVEELM
DEMRPSAEEQEDPDWLWTDEDEREIYDEALAKALEESEGIAWAAGNIRIGELILIIDSDT
RVPEDCFLDAASEFAQSPNIAIIQHESAVMQVVGHFFENGITSFTTRINTAISFCAANGE
VAPFVGHNAFLRWAAIQDASFIDADDGIRKCWSESHVSEDFDQALRCQMKGWSLRWAAYS
NGGFQEGVSLTADDELNRWQKYAYGCSELLFHPLRNWFTKGPITPLYRSFVWADGIPLHS
KISVLAYISSYYAIACALLLSLVNWVLIGLFDDVLDLFYLSSWQVFLTCIVIFCGLSNVS
SALFQYRLNTNSLGNALIQNFKWIVFFFFFFCGMSWHLSTALCAHLTGYNMQWASTVKEV
ELSHFFKEWPAMWKRFWDIWIVSWVMILGVAFMASPLVPTGYRITNFTCILPLMAQACCH
FLYPIVLNPWLLLFQF

Enzyme Prediction     

No EC number prediction in I303_02120-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	593	807	1.7e-54	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	8.63e-50	592	808	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	2.95e-08	438	700	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	7.46e-07	590	865	138	387	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	0.002	569	745	73	227	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
225494	MdoH	0.002	584	745	227	395	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ81467.1|GT0	0.0	1	976	1	981
CED83368.1|GT0	0.0	118	976	167	1061
ACZ81448.1|GT0	1.54e-282	111	975	60	945
CCA68526.1|GT0	6.84e-251	118	976	4	871
BAC77594.1|GT0	2.84e-233	118	976	41	927

PDB Hits     

I303_02120-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

I303_02120-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

Start	End
341	363
383	405
785	807
822	844
864	886
916	938
945	967