CAZyme Information: I303_01429-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_01429-t42_1-p1
• CAZy Family: GH1
• CAZyme Description: alpha-N-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	KI894027|CGC9	63218.20	6.5806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:3856543-3858994(+)

Full Sequence      

MAAYSQHTTVLQALHQQQSVVTFRATPDHPAELRSTPLNLDVDRLVHPAEPPITDKLYSG
FLEHLGRCIYGGIVDSPKTPSPSKLLVKQDKSGPLYKGRLGWRKDVMSCLAKDGELEVPM
MRWPGGNFVSNYHWQDGIGPISQRPKRIELAWLSDESNIFGTDEFIDYCRALGSEPYICL
NMGTGTLEEALSWLEYCNGTGDTHWAELRRKHTGRKEPHNVKYWGLGNEMWGPWQVGNML
PSEYARKARQWAHALKLVDPTICLISCGETGASEWDREVIGALLPWADMHSIHFYVPGLD
YEKNVFGPVAAEKHLEICKSLIDMANIGRTLERMPARDMKICFDEWNVWDDVKAAGSNGL
EQVYDYTDMLGFCAWLNVLVRKHKDIGIACLAQSVNVISPLMTRPDGILRQTLYYPLELF
SKYMKHGHLLQLPSFPDVYTGPTYPVYIQQAGYNPSYIDSVAVLVKTPEGLSIRVSVLNR
HPTADWVTNIGFSGFELRNVKIHEIYHDDLVATNTFENPNNVKPVATSLSKEGWTTEYAN
GFTVKKHSWVFLIFDGIKV

Enzyme Prediction     

EC	3.2.1.55:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	50	552	2.2e-125	0.7047619047619048

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226064	AbfA	4.55e-133	51	552	15	496	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
214830	Alpha-L-AF_C	8.84e-51	344	548	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
399741	Alpha-L-AF_C	7.25e-44	344	548	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44890.2|GH51	0.0	1	556	1	562
UOH84770.1|GH51	0.0	1	556	1	562
AUB28950.1|GH51	0.0	1	556	1	562
AGV14838.1|GH51	0.0	1	556	1	562
AFR98761.1|GH51	0.0	1	556	1	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ATW_A	2.33e-109	45	542	6	471	The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]
3S2C_A	2.48e-109	52	542	15	471	Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
3UG3_A	4.52e-109	45	542	26	491	Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG4_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG5_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima]
1PZ3_A	2.42e-81	53	549	19	494	Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],1PZ3_B Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],6SXU_AAA Chain AAA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXU_BBB Chain BBB, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXV_A GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus],6SXV_B GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus]
1PZ2_A	1.85e-80	53	549	19	494	Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1PZ2_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NIX4|ABFC_ASPFN	3.03e-147	46	514	17	470	Probable alpha-L-arabinofuranosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfC PE=3 SV=1
sp|A2QQ94|ABFC_ASPNC	7.12e-146	46	552	17	500	Probable alpha-L-arabinofuranosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfC PE=3 SV=1
sp|Q4WTB3|ABFC_ASPFU	7.12e-146	53	464	26	426	Probable alpha-L-arabinofuranosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abfC PE=3 SV=2
sp|B0XQB2|ABFC_ASPFC	7.12e-146	53	464	26	426	Probable alpha-L-arabinofuranosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=abfC PE=3 SV=2
sp|Q5BDV3|ABFC_EMENI	1.38e-145	31	481	8	440	Alpha-L-arabinofuranosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=abfC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_01429-t42_1-p1.