CAZyme Information: I303_01273-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_01273-t42_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		77780.74	4.6083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:3437151-3440010(+)

Full Sequence      

MINSPTLTPRNLVLLLLLSPWTSSIYGQYDASSSGYQVQTPPLKTDWTDKVGTDPWTEYP
RPQQIREDWQSLNGIWRYQKASNASEITNLPTNVDEKWGKAVMIPSCIESGLSGLQVDLK
DNEFSWFQTKFNVPSNWSDKSLLINFGAVDYEATVFVNGKNATTHKGGFTRFDAEISSLV
EYGKDNELIVFVHDPSDSKEHIIPVGKQTNDPSHIFYTPCSGIWQSVFIEPVPKSYIRRV
DLSGDMHGVGTINVHTSDSSSQSVKIAISDSEGTAYEASGQSDSSFNFTLPNVKLWSPDS
PTLYNVTVTMGDDVVTIYTGFRSLSKGDVDGVIRPLLNGEFIFAFGTLDQGYWPDGIYTP
PSYEAMKFDLKFLKEKMGFNMVRKHIKVETDLFYRACDEMGLLVIQDMPSTTARKEFLPN
AAQQAQYVEELKELVNLHKSFPSIYTWVVYNEGWGQPLDGPETKHAPMVRDLDPTRLIDA
ASGWHDHGAGDYSDNHHYPDPQCGMTNAEDPSGPYDPARIGFQGEFGGLGYNVSIDHLWN
VPKAIKAINQTYEIDETLEKWNSRSRDLLIMLESQVSNYACSGAVWTQTVDVEGEINGLM
TYDRRMERVDLAIWKEAITNLYKAAEQRGAGSGSGSGSGSGSGSGSSANANSKEENTTKV
QSAVATAGLSGTNDTRSNGALSSSEGIPSACMMGLIGVMGCILSNI

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	61	501	1.4e-97	0.511968085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	1.99e-36	59	476	3	443	beta-D-glucuronidase; Provisional
225789	LacZ	5.30e-36	55	478	1	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.93e-14	121	478	107	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	1.56e-09	236	322	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397120	Glyco_hydro_2_N	1.59e-09	70	233	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54330.1|GH2	2.76e-263	11	628	4	615
EAA64506.1|GH2	3.87e-262	31	628	23	612
UDD59220.1|GH2	5.61e-261	11	630	7	633
QMW41001.1|GH2	7.96e-261	11	630	7	633
QMW28926.1|GH2	7.96e-261	11	630	7	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.35e-110	43	621	12	582	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	2.37e-29	61	482	11	454	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	6.42e-29	61	482	36	479	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6ECA_A	4.44e-27	59	474	31	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
4JKM_A	2.18e-26	72	476	18	441	Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26257|BGAL_THETU	7.70e-22	125	476	56	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	2.79e-21	56	476	40	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	3.27e-21	125	449	58	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|Q56307|BGAL_THEMA	1.26e-19	36	478	3	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|P05804|BGLR_ECOLI	6.06e-18	70	478	13	441	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000423	0.999540	CS pos: 27-28. Pr: 0.8401

TMHMM  Annotations     

There is no transmembrane helices in I303_01273-t42_1-p1.