CAZyme Information: I303_01185-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_01185-t42_1-p1
• CAZy Family: CE4
• CAZyme Description: polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	KI894027|CGC16	52793.03	4.5574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:3178307-3179902(+)

Full Sequence      

MWSKILVAGTLLTSALAGVIDLTVPSAGELLSELDAVLHPQSEPHLISYNENYLDPETQT
NRKHCTLRARGDEKDDSDNLVTAVKKCGKGGIIKLPDANYTIGKPLDIYLENAVLDIHGW
LSFTTDIPYWIEHRIYFPFQNQSLAFVIRGHDYVINGNDKGGIDGNGQVWYDYAKDFGNK
YGRPMSLTIKDSKNVVVKNFSIIQPQFWASLVWGSENVLFKDFYVNATSFNPESSSDEKN
WLQNTDGSDTYQSYNVTYENMVYQGGDDCIALKPNSTLIVAKNVTCVGGTGIAFGSIAQY
PGVKDIIEDVYMENLNLYPSDQCPGYQGVYFKSWIGVPVGHEPNGGGGGYGYARNITVKD
VYMEDIWHPVVVQTDLTYLDIDRSQYTDTSLFEWSDIHLKNFTGTGLGNRLVWMNCAKAT
PCFDWTFEDIDLKPGKTDHPEISYTCNNVVLGGKDGLNQCHPSNSTLETNAGGSI

Enzyme Prediction     

No EC number prediction in I303_01185-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	135	449	5.4e-65	0.7815384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.71e-28	147	449	47	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	7.02e-23	46	448	54	417	polygalacturonase ADPG
215120	PLN02188	1.00e-20	69	449	44	390	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	3.54e-18	161	434	151	396	Probable polygalacturonase
215540	PLN03010	3.83e-16	230	467	199	409	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB28044.1|GH28	2.74e-253	29	475	34	479
AFR97960.2|GH28	2.74e-253	29	475	34	479
AAW42245.1|GH28	5.07e-251	46	475	49	478
ADV21054.1|GH28	6.21e-251	29	475	30	474
KGB77456.1|GH28	8.81e-251	31	475	32	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.31e-25	62	405	16	331	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	6.35e-12	80	427	11	326	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NJB0|RGXA_ASPFN	1.10e-121	63	433	29	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	1.10e-121	63	433	29	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|A2QBB4|RGXA_ASPNC	2.77e-111	56	432	23	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	7.81e-111	56	453	23	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2RAY7|RGXC_ASPNC	1.18e-68	59	460	24	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000342	0.999604	CS pos: 17-18. Pr: 0.9744

TMHMM  Annotations     

There is no transmembrane helices in I303_01185-t42_1-p1.