CAZyme Information: I303_01121-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_01121-t42_1-p1
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	KI894027|CGC10	53389.69	9.0612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:3019670-3021496(+)

Full Sequence      

MTRYQRLSVVFQRNPTTSIVLLAAIIRISHIAFLYILSSLIPPFDTSHTLLTADQPSTGG
LPGLRWDAIHFVSIAKDGHTHEQQLAFQPLFMGILRLAGEVVSCFKRIEGADEGAGVRVG
DVVWGGMVVSSICWVGSCVLLYKLSTHLFNVRFALLATLLYMIPPSPVPSLPYTEPLYAL
TTFGGIYLAVAKRRYTLSGFLFACSTATRATGIFNVIILCGVILLDGIPISALDSRIILK
RCLTRSWTAIVPCLLTVSPFLVFQVYAYQSFCHDPSMARPWCESKVPFAYGFVQKEYWNI
GFLNYWTISNIPNILLPFPILITSLLGTIKHFKSLSLRTKRIHRNHTQHGIIKANNELTV
TILYIHHIIMMCLILFNSHVQILLRTCITDPVIWWNVASVSVDWVPETATEAEPKSGSGK
KIKNDDANSPCEIPQLQPGKREDKWQLNGIGRFWIYWSVIWGTVSTILWVGHYPPA

Enzyme Prediction     

No EC number prediction in I303_01121-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	20	476	2.7e-91	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.71e-36	19	403	4	397	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.41e-09	1	398	10	364	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21212.1|GT76	8.65e-107	14	476	5	425
AFR93820.1|GT76	2.09e-106	14	476	5	420
AUB23397.1|GT76	2.09e-106	14	476	5	420
KGB77682.1|GT76	3.24e-106	14	476	5	423
EAL22094.1|GT76	1.83e-105	14	476	5	423

PDB Hits     

I303_01121-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	3.25e-106	14	476	5	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	1.03e-104	14	476	5	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.64e-29	13	401	2	327	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q09712|GPI18_SCHPO	2.61e-27	64	402	126	428	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q2UJS7|GPI18_ASPOR	8.62e-25	33	321	34	327	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000002

TMHMM  Annotations     

Start	End
19	41
122	141
148	165
169	191
212	231
246	268
300	322
358	380
450	472