CAZyme Information: I303_00654-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_00654-t42_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	KI894027|CGC18	61296.32	4.3571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:1731753-1734046(+)

Full Sequence      

MRTVHQSALVALFGALNVLALPAALPQTAADPAAAVSASGGISSSSTTGFTYTCQNDKQW
TDSSGNTNPCQGDTVCKEGVDGGPCVWPEGYGVVALAETGASVPAASVPSAAAGPVGASS
AGGSAPLGVASSSAGGAVPSAPAGYAASSATPVAAPSGSQASPAAGGAVPQASSALAASS
AASAPGASGTASSSSSANTTSTTSGNSTTGSNSTVGGSGSSAKSGGTNFVGYWDNYANLG
GIQASQVDGLTHIILSFVDMETWTTSTSSFAQSSNGNFDATTPDTLKGMNSRLKVTAALG
GWGLDQAIKTAADGGETAIAALIENAKGVVKQWNLDGLDLDWEFPTSAQQPAFVSMVQGL
KKGIQEVKSDGILSVAIGSRTTQKDPKTGHSDVEALTSETFSALNDVVDMWNVMTYDYLN
RYDTKTTHQGGGVVVEQTLKYYEGVGIDLSKVNIGFLNTAKFFRKVDSCSASEPIGCPLG
GVNTYETGGEDNGESGWLRYNPEMDEGLGDIAKKVTTQVRPQFEARPDDSQTAFEAEKAH
AWYDETNKVFWTWTSPEDNKAVCEEWKSKVGGMMVWSLNQDENGQAGGSHMKALVECVKG
A

Enzyme Prediction     

No EC number prediction in I303_00654-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	228	587	9.4e-41	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	3.97e-41	230	581	3	334	Glyco_18 domain.
395573	Glyco_hydro_18	1.33e-39	228	581	1	307	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	4.03e-29	229	417	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	2.94e-25	230	581	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.59e-23	230	581	2	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46130.2|GH18	1.73e-127	1	601	1	531
KGB77350.3|GH18	7.43e-123	49	599	27	517
AFR94094.2|GH18	7.26e-120	230	601	165	530
AUB23701.1|GH18	7.26e-120	230	601	165	530
UOH83768.1|GH18	1.44e-119	230	601	165	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6G9C_A	1.64e-10	277	582	85	374	Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]
3QOK_A	1.28e-09	286	516	101	347	Chain A, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1HKK_A	1.36e-09	251	582	31	343	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]
1HKI_A	1.37e-09	251	582	31	343	Crystal structure of human chitinase in complex with glucoallosamidin B [Homo sapiens],1HKJ_A Crystal structure of human chitinase in complex with methylallosamidin [Homo sapiens],1HKM_A High resolution crystal structure of human chitinase in complex with demethylallosamidin [Homo sapiens]
4NZC_A	2.08e-09	286	583	81	385	Crystal structure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95M17|CHIA_BOVIN	8.00e-10	232	582	27	366	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.72e-08	251	582	52	364	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P32470|CHI1_APHAL	2.04e-08	286	484	115	312	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q9W092|CHIT2_DROME	7.20e-08	286	582	111	390	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|Q873X9|CHIB1_ASPFM	3.47e-07	286	584	121	392	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999689	CS pos: 30-31. Pr: 0.6666

TMHMM  Annotations     

Start	End
7	29