CAZyme Information: I303_00302-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_00302-t42_1-p1
• CAZy Family: AA14
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		71175.93	6.8122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:798557-801159(+)

Full Sequence      

MSPPAAPGSPYTSNHISSPTISSFSQMSSQTKSDGSQADGGEKKSQRLIVVSNRLPVTIS
KDANGEYHFKMSSGGLVSALSGCKKTMEFTWIGWPGKYIPVEDRDHVNDRLLKEYNCFPV
YLNDDLADKHYNGFSNSILWPLFHYHPGEMNFDAAHWLAYREANMRFAEVVSNFCQSGDM
VWVQDYHLMLLPMLLRSMISGESAQGEMVRKELGRVKEGVDDEVVKDVLGMQPGVAQAVE
HTDEGVEMLDDVEEDGELLQMKARRPHFPRGLSTFQKQEIAAKEKGKDGIRIGFFLHTPF
PSSEIYRVLPVRREILLGVLQCDLIGFHTYDYARHFLSSCTRILGLQTQPNGIEFEGRYA
QVGTYPIGIEPMQFVEGLQQEKVQKRLKALETRFQGCKVIIGVDRLDYIKGIPQKLHALE
VFLTQHPEWIGKVVLVQLAIPSRQDVEEYQNLRACVNELVGRINGRFGTVEFMPIHYLHK
SVSFEELTAMYALADACLVTSTRDGMNLVAYEYISSQSQRHGSMVLSEFAGAAQSLNGSI
LINPWDTQSTADAIHSALEMGPEQRKSNWEKLFNYVSKYTAEAWGTTFVNELTRLSGLPP
NGPAGPGRKKSGSLSRTSSKASIRRRASQASVVAPSA

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	289	594	1.1e-140	0.6442105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	46	594	1	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	0.0	47	594	2	462	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
274112	trehalose_OtsA	0.0	47	594	1	456	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]
215556	PLN03064	0.0	37	603	85	578	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	0.0	36	592	5	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR94553.2|GT20	0.0	44	633	55	645
AUB24224.1|GT20	0.0	44	633	55	645
AAW45200.1|GT20	0.0	44	634	55	645
KGB79877.1|GT20	0.0	29	631	42	643
ADV24479.1|GT20	0.0	29	631	42	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.87e-230	47	596	13	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	4.41e-229	47	595	1	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.31e-219	41	596	6	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	9.03e-210	47	596	5	471	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	9.03e-210	47	596	5	471	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59921|TPS1_EMENI	5.61e-234	40	596	3	478	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1
sp|Q00075|TPS1A_ASPNG	6.84e-231	47	596	14	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|Q4WLM9|TPS1A_ASPFU	1.47e-229	47	596	13	478	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|A0A384JAD8|TPS1_BOTFB	1.84e-227	43	596	10	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TPS1 PE=1 SV=1
sp|P40387|TPS1_SCHPO	4.22e-226	40	595	13	484	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_00302-t42_1-p1.