CAZyme Information: I303_00030-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_00030-t42_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	KI894027|CGC13	26318.73	5.9766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894027:80043-81202(-)

Full Sequence      

MILLKTLSVLWLIHSNSDASPVQFIDKRALPRVGGVNLAGCDFGMSTDGSSGTSYCPGTD
QISHFVEKGANIFRLPVGWQYLVGNNQASTSLDSTFFATYDNLVKTALATGWYVMIDVHN
YARWNGGVIGQGGPSDNDFANLWKLLAGKYKSESKVIFGLMNEPHDVDINQWATTVQAAV
NAIRAAGATTQSIALPGNQWTHPEGWISGANDPLLASTPDISLRQVQCCLIITPDVVERY
RPG

Enzyme Prediction     

EC	3.2.1.4:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	35	218	1e-61	0.6453900709219859

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.68e-46	36	220	1	183	Cellulase (glycosyl hydrolase family 5).
225344	BglC	7.48e-13	67	202	84	233	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB92618.1|GH5_5	4.73e-90	3	221	6	223
ABP02069.1|GH5_5|3.2.1.4	7.69e-89	3	221	6	223
AAC60541.1|GH5_5|3.2.1.4	5.93e-86	3	221	6	224
BAA03070.1|GH5_5|3.2.1.4	5.93e-86	3	221	6	224
AAR29981.1|CBM1|GH5_5|3.2.1.4	1.22e-63	27	221	90	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QR3_A	3.25e-64	32	220	4	208	Chain A, Endoglucanase EG-II [Trichoderma reesei],3QR3_B Chain B, Endoglucanase EG-II [Trichoderma reesei]
5D8W_A	9.59e-56	35	223	26	227	Structrue of a lucidum protein [Ganoderma lucidum],5D8W_B Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_A Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_B Structrue of a lucidum protein [Ganoderma lucidum]
5HOS_A	5.31e-31	35	208	31	203	Crystal structure of the endo-beta-1,4-glucanase Xac0029 from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
5I77_A	1.00e-29	35	207	6	174	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	1.04e-29	35	207	8	176	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04469|GUN1_SAIFL	1.05e-86	3	221	6	224	Endoglucanase 1 OS=Saitozyma flava OX=5416 GN=CMC1 PE=2 SV=1
sp|P07982|GUN2_HYPJE	1.31e-62	32	220	94	298	Endoglucanase EG-II OS=Hypocrea jecorina OX=51453 GN=egl2 PE=1 SV=1
sp|A0A024SH20|GUN2_HYPJR	3.66e-62	32	220	94	298	Endoglucanase EG-II OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=egl2 PE=1 SV=1
sp|Q66NB7|EG5A_PHACH	4.68e-55	15	220	60	265	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|P58599|GUN_RALSO	4.88e-31	35	213	119	308	Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=egl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000667	0.999313	CS pos: 19-20. Pr: 0.9634

TMHMM  Annotations     

There is no transmembrane helices in I303_00030-t42_1-p1.