CAZyme Information: I302_09222-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_09222-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: mannosyl-oligosaccharide 1,2-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939		105666.29	4.8860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KV700382:944007-947212(+)

Full Sequence      

MLSPKQNGKTMPYTPAYTQDVEKGLSSPTKIARRFVSRKPRWIVGGLILFGVVFYFYESG
PPLPPKDLAPPHPPHHHGPPPGHGWSAGDEWDEDHNDDDDDDDEEEEEDEEDEDEDKGWK
NWIPFGGKPKPPKVGTEPTKTSTEIQYDFVLDNNGDQYVTNWVQPIAPLHPDLSLLPPPE
DLLPEINLRESSPPREEVYPDDKLRMIISPTPDNEEIPRNTIPPDAWATKWMEERRPEDW
KGQKGDMKKVQWSGFARGRDNWENAKQKKEREKRRDAVKRGFKHAWEAYKRHAWGHDEVR
PISQTPSDPFNGWGATIIDSLDTLLLMGFSDEYNLCRPHINQVNFHWVNGRDWSSGYITE
DEDGTGEVYALPRDKGVGLPVFETGIRYLGGLLGAYDLSGDKLLVERAEDLANVLAKAFD
TVSGLPAGRIDPGLPAGEQIHLSTVSIAEVGSMSLELIRLSQVTNDRKWFDLAQRAMEYL
EERVIPRSTQPPLIPMWFQPDASIEHVQAGGFTFGGLADSYYEYLIKTYKLLGNNEHAEV
WKKVYAESIDKAKEILYKDIEVVPDRELFTIGKFEHGRLIHELEHLTCFAGAMLGLGAKL
LDGRDGDMVDAEKLTRTCYWLSADTPTGLQPEVMEWYQPHEVEMMYENVTLENSGMYRPP
LSSQDIEDAVNSGENIQGTHKDMNGLLRWNNDGSIVTSRDPSDDPVQYARKLKGRPTGAR
KVVGRGINRPETIESIFYMYRLTGDRSWQEKGWKMFVSWMETAKVDGGVSSVDDVTKERG
QLRYGDNMESFALAETFKYHFLLQSEPDILSLDDYVLNTEAHPFLVNPKLDPTSSTSHVR
YWTPSSDQNLGVRSQGTNTQKFARLNVIDRIRGPARGPPVIQHFGQGGPGQGPPPPPGGG
KGMGGGGGRPGDRPKPPPGFGMKKIKVGEEGGAKFPDDF

Enzyme Prediction     

No EC number prediction in I302_09222-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	282	825	3.5e-138	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.68e-173	282	826	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.88e-117	269	829	67	521	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	6.82e-04	376	480	90	175	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23425.1|GH47	0.0	2	878	5	827
AFR96466.2|GH47	0.0	2	874	5	824
AUB26389.1|GH47	0.0	2	874	5	824
UOH82871.1|GH47	0.0	11	874	1	810
CAY09771.1|GH47	0.0	2	874	5	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	6.62e-69	282	823	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	7.75e-69	282	823	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	8.16e-69	282	823	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	3.58e-68	282	823	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	5.60e-68	282	823	96	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	7.92e-66	282	823	257	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q9C512|MNS1_ARATH	1.67e-62	274	840	97	550	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	2.96e-62	274	831	98	542	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	3.26e-62	274	823	207	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	1.15e-61	274	823	208	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000012

TMHMM  Annotations     

Start	End
40	57