CAZyme Information: I302_09171-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_09171-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: plant-inducible protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		45153.58	6.5542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KV700382:816232-817694(-)

Full Sequence      

MSDTIAPLSLTQEKSADLISLLTDGLLHIKDQSGRFLLKLHDGTLVDTKGWEHPTVFSWE
WTHGIALTALCHVASPGAQKSLKVALDWFETQWKRTDGKGAPKNINTMSPFYSLACFVED
GRTKDPKWNGWIDEWAEWIMKGLPRTEEGGFQHMTYVNMHENNLWDDTLMMSVIPLAKIG
ILLNRPHYIDEAKYQFLIHIKYLADTVSGLWYHGWQFTPEKIEGGNGGAETNGGHNFAKG
LWARGNCWITVSIPMFLDILGDKLPPTDPIYRHLVSIWRRQVDAFVRSQDPKTGLWHTLI
VDPTSYVETSAAAGVVAGIYMGIRQGLISDPVYRKCADTGLAGVIAQIQPDGEVANVSFG
TGMGHSLQFYKDIAITSMPYGQALAMHALVEWQRLQRGEGAASKA

Enzyme Prediction     

No EC number prediction in I302_09171-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	394	2.4e-102	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.67e-79	54	395	29	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.97e-69	29	396	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22466.1|GH105	4.19e-203	8	400	36	456
AFR92981.1|GH105	4.19e-203	8	400	36	456
AAW41249.1|GH105	1.18e-200	8	395	37	453
ADV19987.1|GH105	5.96e-198	8	395	38	451
KGB75254.1|GH105	5.41e-197	8	395	38	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	9.43e-111	19	394	12	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	6.95e-110	18	394	29	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.51e-102	18	394	30	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	2.79e-11	144	345	110	299	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	8.31e-35	57	391	27	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	4.20e-11	165	354	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I302_09171-t42_1-p1.