CAZyme Information: I302_08959-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08959-t42_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		54071.61	6.0725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KV700382:297477-299889(-)

Full Sequence      

MSEPRSHFVFGTIAPFSHVPPVIEVSLALLTHTPDLCISVILHVNNLENSQSLIETQGVA
EHVKSRIKLIPVGEKRAWNDLTGSYIDVIYKGGEGYEGVLLDSAPWPHPSTFIYDGAGFF
WISVKSKVEENFPQLRPPKLVAYGPLPIGEMLYLAGSEQNGSTRFINNALEAYPEVQNAP
QSKLLQGDLDVENSDFGAQAAHLLKQADAYKALLSGWQECTTAPEAWITCFPASVLEPET
LEAFRKDEYFTARGKKEVIELGWSERRPKIDLGQGVREFLDKQRDKSVIYISFGTLVDAG
PTLPALFDLLKEINTPYIYACGRQKHSLPQYIKDTLASSEKEGICIAPDWLDQVGVLSHK
AVSCFVSHCGANSYVEAIEAGVPIIAWGKRGDQVTLASRVHSSGLGIELLQHRTGFSIGK
EVAHRKGVIIKGTPEALKEEVRAALDTINGPEGEEMRKRARKLSEEMSEKRRGEWVENIK
KFGLYGRE

Enzyme Prediction     

No EC number prediction in I302_08959-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	266	468	3.6e-25	0.3795811518324607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.22e-29	278	479	231	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
178572	PLN02992	6.68e-20	276	468	253	447	coniferyl-alcohol glucosyltransferase
178170	PLN02555	9.12e-20	278	466	269	445	limonoid glucosyltransferase
215127	PLN02210	1.97e-19	278	463	261	428	UDP-glucosyl transferase
177813	PLN02152	4.21e-18	167	482	151	450	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW23591.1|GT1	6.31e-22	1	463	2	476
QRW23605.1|GT1	3.83e-21	276	469	290	489
QRW25636.1|GT1	9.21e-20	1	463	2	475
QRW23585.1|GT1	1.69e-19	276	463	287	480
QRW23594.1|GT1	5.09e-19	213	469	68	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ACV_A	6.72e-16	268	438	256	417	Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula],2ACV_B Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula]
2ACW_A	6.78e-16	268	438	256	417	Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula],2ACW_B Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula]
3HBF_A	1.53e-15	269	446	256	436	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
6LFZ_A	1.56e-15	236	407	222	393	Crystal structure of SbCGTb in complex with UDPG [Scutellaria baicalensis],6LFZ_B Crystal structure of SbCGTb in complex with UDPG [Scutellaria baicalensis]
6LG0_A	2.75e-14	279	407	255	390	Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_B Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_C Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_D Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_E Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_F Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O23406|U75D1_ARATH	2.04e-16	80	457	92	442	UDP-glycosyltransferase 75D1 OS=Arabidopsis thaliana OX=3702 GN=UGT75D1 PE=2 SV=2
sp|Q2V6J9|UFOG7_FRAAN	9.03e-16	278	465	271	454	UDP-glucose flavonoid 3-O-glucosyltransferase 7 OS=Fragaria ananassa OX=3747 GN=GT7 PE=1 SV=1
sp|Q43641|UFOG_SOLME	2.26e-15	275	449	247	421	Anthocyanidin 3-O-glucosyltransferase OS=Solanum melongena OX=4111 GN=GT PE=2 SV=1
sp|Q0WW21|U75C1_ARATH	5.97e-15	278	436	260	420	UDP-glycosyltransferase 75C1 OS=Arabidopsis thaliana OX=3702 GN=UGT75C1 PE=2 SV=2
sp|A6XNC6|UGFGT_MEDTR	7.89e-15	269	446	256	436	Flavonoid 3-O-glucosyltransferase OS=Medicago truncatula OX=3880 GN=UGT78G1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000004

TMHMM  Annotations     

There is no transmembrane helices in I302_08959-t42_1-p1.