CAZyme Information: I302_08842-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08842-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	KI894026|CGC5	58772.41	6.1988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894026:1211295-1213291(+)

Full Sequence      

MVRSAEHIARSKALEIRVHPDGRYLVSGGKNEPFFWQADTAWEIFHRLDEDEVKLYLNKR
AKQGFNVIFGVLFAEHGGSTLPNRQGEWPFHPKDPDAKEYYPDVFRPNEKYFEFVDFVIN
YAASVGIRVAIQPVWGNYVAGIYHRIEHYFDNVDAALAFGKYCGQRYPFLPYLNGGDTQR
YWFDDAVFNARAGKPTRAPHVKIIDYGPVFEAFADGIVAGESSHRTDGSQPFITFHPTAS
WLPDTPEPYASHLFPHSKWLTIDAIQSGHSCALKYPPLTDPSIGTLHFFLAQNSVDHVRE
MYATSTRDGTLRPVIDLEGHYESTHYDFKPERDQWKASNIRQGAWQAMFAGAAGVTYGVN
SVWQMNNLNSKSHPPIPHHTVSAANWYDELDLPGATYVGNITRWFLSRPSYFSRIPDQSI
LISDTFDRPVPDDDYDGKDAKLISATRDSNGKWLAVYTPVGHEFKVDTSSLNGDTLSAVW
YDPRSDKEISAGSVESGRVVARPPSSGKDDHDWVYYVAAV

Enzyme Prediction     

No EC number prediction in I302_08842-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	16	514	1.1e-82	0.9902912621359223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	6.55e-87	21	408	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	7.18e-20	415	514	1	88	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KNX49908.1|GH140	0.0	1	518	1	518
KAE8421181.1|GH140	3.08e-96	21	520	34	511
KAE8361514.1|GH140	4.33e-96	21	520	34	511
KAE8156220.1|GH140	8.36e-96	21	514	34	504
KAE8332162.1|GH140	1.66e-95	21	520	34	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.43e-35	18	497	20	424	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.99e-34	18	497	20	424	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

I302_08842-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_08842-t42_1-p1.