CAZyme Information: I302_08790-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08790-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45139.62	7.1817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894026:1098483-1099908(+)

Full Sequence      

MAMVLQLTTFLQQWLYSRPDVKALGKESDAVRLGIIGGSAMINAASIIHPAETHPGARIV
AVASRDIKDAQKAAKQFNIPKAYGSYEELLADPEIEAVYISVPNGLHGEWAIKSLQAGKH
VLLEKPFTSNGLEARRVFDEADRAGKICVEAFHWQFHPAAHVVKSLIASGKFGDIKRTFA
RMVTPKGTIPGNDIRWKWDLAGGALMDETYALHATRYFVGADNETLLPTGIKPTVLSAIS
KPWSKDQRVDSASWADLRFDLEGGKTVESKIYVDMDQPNLALVIPRAWELPSIEIECEKA
TIYYFGFMMAHVYHYISIYDKVTKHTTYQKHYNYGPKWKDVGDPHWSTYRYQLEAFVDKV
RGREPKHWITPEDSIAQMESIDAIYMKNGLGVRPVTGELEGQ

Enzyme Prediction     

No EC number prediction in I302_08790-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	28	176	1.9e-18	0.38847117794486213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	1.58e-54	31	385	4	329	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	1.67e-28	31	152	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	8.66e-20	31	175	2	145	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
183212	PRK11579	2.53e-13	28	176	2	146	putative oxidoreductase; Provisional
182305	PRK10206	1.10e-10	87	175	57	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URX63132.1|GH0	3.57e-12	55	173	27	145
BBH24596.1|GH109	2.02e-11	31	175	3	142
UPK44969.1|GH0	1.07e-10	80	208	53	179
QHW35532.1|GH109	2.74e-10	31	271	3	240
QQO45271.1|GT4	3.58e-10	25	220	354	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RBV_A	4.36e-26	27	224	24	218	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]
3RC7_A	1.55e-25	27	224	24	218	Crystal Structure of the Y186F mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RCB_A	1.55e-25	27	224	24	218	Crystal structure of the K102E mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RC9_A	2.92e-25	27	224	24	218	Crystal Structure of the K102A mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
4HAD_A	1.93e-24	31	222	24	213	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49305|YMO1_RHIML	8.84e-34	29	224	2	195	Uncharacterized oxidoreductase ORF334 OS=Rhizobium meliloti OX=382 PE=3 SV=1
sp|D4GP30|XDH2_HALVD	3.75e-32	34	385	4	313	D-xylose 1-dehydrogenase (NADP(+)) 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=HVO_B0029 PE=1 SV=1
sp|Q9ALN5|SPNN_SACSN	8.91e-26	31	219	5	190	dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase OS=Saccharopolyspora spinosa OX=60894 GN=spnN PE=1 SV=1
sp|B3TMR8|KIJDR_ACTKI	1.69e-25	27	224	6	200	dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase OS=Actinomadura kijaniata OX=46161 GN=KijD10 PE=1 SV=1
sp|Q9DBB8|DHDH_MOUSE	2.36e-25	30	241	2	202	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_08790-t42_1-p1.