CAZyme Information: I302_08577-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08577-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1630	KI894026|CGC8	181940.54	4.6800

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894026:583636-590301(+)

Full Sequence      

MRAVISLISLLGYLLNIGSVALADSPPISIFLETSWAAPPLLLEILETVYDESPSSYFPL
LSLLPNLSSEEYHSDQTLLESIKNLISSYSLLPGSESTLDLALALHTAVPRIQAQFSWYD
SAIRPREGQLGVGHCRDDGWAEWRGKGFCEVEELRRDMEMSIEEGLHHSDTQPEILPFDH
KSSPPSSSSSSAILYFKPHSSNSADLLNYLSYHESQFPNFNYIVRYLPPSSLSASDTEMR
KKTPLSGWGVEMALKKMDYLVVDDRLTGSSSSPQDQNKSNGQGKSEKGIFDDVLGKDPWS
DSATPLTPAEIRDLGLKASTLIKSSDNPLEALKELSQDFPKYSASLARQVQVTDEVRDKV
KSILRRGEASEAIYINGKGWTEGLDAYGLLRAVRAERHHVLSLTSLGLTPKQAIDLIADP
VIGEAQVEDSPGEGTVDSSDRVEGGDVIVYWNNIEKDKRYKNWPTSLGGFLRQLYPGQFH
TVRKNTWNLVFVFDLAQVSSLDIIANSISPMIQRGLPIRFGVVPMFDTEKEDISAQMAKI
FHYVVKTFGRGSTRDFLADLVSSTPHSPQLPGVVTLDSVRKAYDMLSFTSTKTGLPFDEV
LLTELFDPHLEKTAAYMTRLTATKEESKLGHLFVNGKHTIVNGQWPMVVQQEMASQLAFL
QEHLMRGEQPEDVANFFYDLPSTSKRRNKLINSGQGEGKLRVFNSLDIFEGDITKRLMND
FVYPGGEGVTPVTMWVVGDLDTKEGQKVVEDALKHVQNPNGASRLGFVHIPIDDPAVLRP
KYRLSTALYQLHASSLLSQATANDLLEVIKGLNRSNDNVDRLVIPSSGEEDIQEAKETGD
VDASGQNCFTLNEEDTKRYFDHHPIQKAAFDGVSAIDIAAAAEFWKIGNGIAKKLGLRDG
KPHLLVNGRLVGPLTPQNFILEDFDTLEAYEYRKRVKPVIDLVQTMYDDISVFDRSTLSN
LISVSSSVIASAYKPDSAEGIFVPTQSARARLYKKLDDGTLSFTLGDSEKAILDVAVIVD
PLSENAQKWSTILQTLSEMDNVAITVYLEPQPSLSEVKLKRFYRSSIPSKLTFDVDGNVI
APGVTFLNLPSTPIYTLGLDAPTSWIVSPKTSPYDLDNLVLSNIHSPVHMSFTLKQLLIE
GHARESSNAPPRGLQLQLTTNDFEVASDTQVMANLGYFQFKAVPGVYDLSIRPGRGREVF
ELESVGSEGWDSANINITGPSVILDSFEGNTILPRFVRRPGMEKADVLVEEERKDSESFA
GAVFSKMKSMVGLSTEVLSTKPKSRHADINIFTVASGLLYERFASIMILSVMKHTDSSVK
FWFIENFLSPTFIEFIPKLAEEYNFQYEFVTYKWPHWLRAQTEKQRIIWAYKILFLDVLF
PMDLDKVIFVDADQIVRTDMKELVDVDLHGRVYGYAPMGDSRTEMEGFRFWKTGYWKDAL
RGRPYHISALYVVDLKRFRQLATGDRLRGQYHALSADPNSLANLDQDLPNSMQDTIPIFT
LDQDWLWCQTWCSDESLASAKTIDLCQNPLTKEPKLVRARQIPEWDLYDREIASFAAKLQ
GQEVGVGALAASVDDLASDANAATTSSHDEAGEVEASDAEGIEEIVEDYETDEEIIDEML
EESRRLDDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1289	1536	9.8e-129	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1289	1536	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1289	1555	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	8.66e-71	436	691	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	8.60e-57	1289	1536	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	1.13e-55	1140	1248	1	108	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74213.2|GT24	0.0	15	1583	10	1561
AAW41515.2|GT24	0.0	19	1579	14	1557
UOH81582.1|GT24	0.0	19	1583	14	1564
AUB22656.1|GT24	0.0	19	1583	14	1561
AFR93153.2|GT24	0.0	19	1583	14	1561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	5.44e-271	23	1563	6	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.97e-270	23	1563	6	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	2.97e-270	23	1563	6	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	9.53e-237	25	1498	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.63e-198	736	1563	451	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	4.77e-217	27	1554	21	1423	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	2.69e-205	23	1563	25	1515	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	9.89e-191	23	1569	42	1536	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q0WL80|UGGG_ARATH	3.36e-190	28	1564	33	1577	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	1.26e-189	19	1552	38	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999723	CS pos: 23-24. Pr: 0.9737

TMHMM  Annotations     

There is no transmembrane helices in I302_08577-t42_1-p1.