CAZyme Information: I302_08420-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08420-t42_1-p1
• CAZy Family: GT49
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	KI894026|CGC1	73629.51	7.2198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894026:160279-163551(-)

Full Sequence      

MPRLIKALTITSILLFLLALHHYLPSSTLTQLKHSRHTAPSSRHKSNPKIKGLRVRRPPS
SGGWSREPYEHSGLGVDHKGLTYWSNQDTTKSKIHPILSLIERGKELAEKQRQKISSIKT
VEDAVDDYQDKFGMKPPKGFDYWYKFTQSIKPHPIPAPSLIPLAHQPFLSFLSLPVSVLR
ERIEIVRSKGAIFTLTFVPPGQGDEGTACDSSQNWLPKDYHHRGKGRVVIDGEEAWGWRC
NNTLTLLLPILSLLPEELFKMNPPLELPFSSDDGPRGMVHNTFREKAENLARSGKVWPMN
QLNKAEQSMRWTYGWAWSCPDNSPLKTRATDLVLNDLHQPDYLTGGESELPQRSSFIADF
ERSADYCSDPDLMDYVSSAVEMTPVVATCKTMWNSDIVGVPLDGVFEKVEYVKWEDKKIS
KAFWRGSATGLFHSRKTPWRQSQRERLHFFAHNATASEESQSILLPNGEIGEYKRAELNG
WLDVGLSGIPAQCDQADGSCDDMAREIEFMGRVRKEDSLKYQYVIDVDGNGWSSRFRRLL
SSNNVVLKSTLYPEWFHETLIPWYHYVPVKLDYSDIHDIMAFFNGSPDGKVRGHDGLAKE
IAKNGYDFVNDHWRLQDMQSFMFLLILEHWRLMSDDRQSASYDP

Enzyme Prediction     

No EC number prediction in I302_08420-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	377	633	1.7e-65	0.916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.01e-24	382	633	30	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.80e-15	374	633	98	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	1.07e-262	70	642	54	629
AUB22757.1|GT90	5.51e-252	95	642	82	635
AFR93241.2|GT90	5.51e-252	95	642	82	635
KGB74299.2|GT90	8.14e-249	1	628	1	621
UOH81501.1|GT90	4.86e-244	95	628	82	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	4.78e-15	438	633	206	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	6.23e-13	335	634	72	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.94e-84	95	643	152	666	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8T045|RUMI_DROME	2.61e-14	438	633	218	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	1.08e-13	438	638	216	394	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	7.24e-13	439	634	198	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.04e-12	335	634	100	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.980883	0.019142

TMHMM  Annotations     

There is no transmembrane helices in I302_08420-t42_1-p1.