CAZyme Information: I302_08363-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08363-t42_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43890.88	6.5034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:1658014-1659321(-)

Full Sequence      

MLKVPKGAPYIVVVLFLYWLLYRHSRNTSTSPFSSNPQLDQFKYHRGKTELINTTALFEQ
SSLEPSIRSVLKVAFGHNQYGSRVIPYFRRKTGTFSAGDVTLVTWLTSDRLGRLVSLAEK
RRAPISVAYYVPPHDKLASRDLILLDKLYRTHPSLSENVDIHLVTSAHLLQLNTWRTVAR
TFATTDWVLLWDADFEACTDYQKGLERFLVQTRARGWADKLEQGTAALVIAPFEWTDPVV
ERSRNLCPIDRDELITMYRNLSIDAFETMTPVLSHATEYDRWIEVGETDYYEVTEYELGY
EAYPLMRRDAEVWFDQRFAGFGYERSAITAQMYLSGMDLYVLPGEYAIHQEHSAAAVIST
HDDIGAAKVPWRTFKMDLCHT

Enzyme Prediction     

No EC number prediction in I302_08363-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	97	361	2e-30	0.744807121661721

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	9.32e-25	99	350	1	291	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08021.1|GT49	3.72e-44	82	352	3	265
CDS06289.1|GT49	2.45e-43	82	352	99	360
CCA70499.1|GT49	4.74e-43	71	352	87	368
CDS10115.1|GT49	1.42e-42	82	352	104	365
CDS14203.1|GT49	2.65e-42	70	352	89	363

PDB Hits     

I302_08363-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q21389|LGE1_CAEEL	1.62e-15	99	355	352	595	Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans OX=6239 GN=lge-1 PE=3 SV=3
sp|Q66PG1|LARG2_DANRE	1.36e-14	99	359	467	709	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q54PG8|GNT14_DICDI	5.28e-14	100	352	348	584	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	3.26e-13	99	353	473	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|O95461|LARG1_HUMAN	3.26e-13	99	353	473	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999545	0.000471

TMHMM  Annotations     

There is no transmembrane helices in I302_08363-t42_1-p1.