CAZyme Information: I302_08346-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08346-t42_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		41740.13	5.0400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:1613164-1614602(-)

Full Sequence      

MQLSTLLPILALLATSTPALASTHRRHSAKAVDHARAVERLATAMERRQPMSEGLKPKRK
VVRKRGTTCKARTTSSSAAEEAATTTSQAAAAATETSAAWIEPAENYTNGTTTSQVEAAS
SATSTSAAAAASTSAASSSSSNGQYTPNGIKAGIAGGDAYDDCESHIGWWYDWSANPSGH
SGTPIAVPMLWGAGTVDSTDSSRLDVFKAITSAPQYIMGFEEPDCSTWGSANIDVSTAAG
LWNTLIGPFKAKGSTLISPSMCHQAAEQYIGWLGSFEKQISVPWDITNIHVNKNNMDGVK
ADIDYYYNTFGKPIWVTEFACVDDSSSFIPCTDQSEINTYINDIVALFEADERVHAYAYS
NGDGLGDVWPMYSNGALSQSGQTYISAISKYH

Enzyme Prediction     

No EC number prediction in I302_08346-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	163	384	2.7e-54	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.86e-59	165	384	16	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	1.54e-88	146	392	7	254
UKZ69748.1|GH128	7.05e-87	146	392	7	254
UKZ94447.1|GH128	4.55e-85	146	392	7	254
QYT06237.1|GH128	1.54e-84	146	392	23	270
UKZ58231.1|GH128	6.17e-84	146	392	23	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	7.42e-132	143	392	195	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	1.18e-89	146	392	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAX_A	1.50e-18	147	387	91	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	2.46e-13	149	387	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	6.07e-13	149	387	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.59e-11	167	386	318	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002997	0.996985	CS pos: 21-22. Pr: 0.9610

TMHMM  Annotations     

There is no transmembrane helices in I302_08346-t42_1-p1.