CAZyme Information: I302_08327-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08327-t42_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	KI894025|CGC7	97452.26	4.9004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:1565539-1569094(+)

Full Sequence      

MLKSPLLENWEFSQVSSEHSPDVHESWNPCSIPTSVHVELKRLGKIPDPYKDLNEWKVQW
IQEADWVFKTQFDVDEAQVNQKHVDLLFEGLDTYCTITLNGKEIATTDNMFLSHRIDVKG
MIKAKSNQLELHFKSPWHEASKAEAENGADENAGNGASNRLYSRKAQYGWGWDWGPVMMT
VGPWKAINLETYDIRLDEIRIDDSLTGEAYDHAKLAASFTLSDTDAEAHQLEITLKDASG
QTIRTVRDHPVSEKLRWDLGKDVKAWYPRGYGDQPLYDLEVQLKNSGGDVLDRITKRVAF
RSAKVIQEPLEGQEGTSFVFEINGIRVFCGGSNWIPADSFLTEIEPGRYRAWVDLLIRGN
QNMLRVWGGGVYEAEELYDACDENGILVWQDFMFGCGLYPSYPKLNESIKLEAEQAVRRL
RDHPSVVIFAGNNEDYALAESIGVMDYKDNSGDYMNSKFPARHVYEVLLPEVVDRLSNIF
YHRSSPYGGKDSSDQTVGDIHQWNVWHGTQEPWSNWDKLAGRFVSEFGMQGYPNIRTVKE
WTDDKSQLFPQSRISVNHNKADGFERRLELYLMENFRHSFDIPSYIYYTQIMQSECLSAA
YRLWRRSFKGRGREYTAGALVWQINDCWPCVSWAIADYYLRPKPTFFTIARELRTYTVGI
TRKDVKTHRDSSTSAFFEIKEEMELWACNSSVNPIDVEVVLETFNLNTSQREQKTFNAQL
QPNASTEIWSGPVPSQPIRTDHSQIPEPIVIQARLYLSSAPDKVEARYSSWPEPYKYLTF
PEPGLKITVKGDEVVLTCEKPVKGLVLDVKGGGDEAIWSDQALDLFPGDEQKVEAKGLGG
RDVTFRYLGDGSA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	730	2.3e-84	0.7087765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.84e-73	5	649	14	626	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	5.86e-13	681	777	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	8.34e-06	199	301	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	5.33e-05	374	515	61	199	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW19045.1|GH2	0.0	31	853	17	851
QRV91212.1|GH2	0.0	25	853	85	927
QRW05283.1|GH2	6.42e-318	25	853	35	891
QRV76379.1|GH2	5.95e-309	25	853	35	888
CED84166.1|GH2	2.25e-296	5	852	7	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.15e-143	10	836	33	811	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	3.51e-114	10	639	15	637	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.67e-114	10	639	17	639	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.76e-114	10	639	17	639	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	9.79e-114	10	639	15	637	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	1.19e-239	5	849	8	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	2.47e-222	5	847	8	840	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	3.99e-218	5	847	8	840	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	7.97e-218	5	847	8	840	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	1.09e-217	5	849	8	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_08327-t42_1-p1.