CAZyme Information: I302_08307-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_08307-t42_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		93898.49	5.6532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:1500993-1504604(-)

Full Sequence      

MPVAIHPSPERSPSKIKLLDVEEVLSKLSLPEKVSLLSGKDNWHTRDIPKFNIPSLRLSD
GPNGCRGTKFFEGVPAACFPCATGLASTWDVELVSEVGVALGDECRAKGVHVLLAPTVNM
LRTPLNGRGFESFSEDPLLSGHLAGGFIRGCQSTGVAATLKHLVCNDQETQRVSSADLSA
LSSEVDERSLREIYLKPFEIAIRESNPWLVMTSYNRVNGKHASETGELITDLLRKEWGYE
GEPFVLSISVHGTYSTDEAIQAGLDLEMPGPSIIRGPALLRMVTCGKVKESEIDERARQV
LKLVNRLIPSGILSNGEENENPTPAIGVMRQSAADAVVLLKNNRKILPLPKTGKRIAVIG
PNASRAQIFGGGSAALRPTYTVSPLDGIKAAVGDGAEVLYARGCDAHKLTPLIGEELINS
KGQAGFDITFYNDPPSSSSRIPIHQLTTTNSNMFFNDNLPEELNRACYATVNATFTPPRS
GIYEFGVGALGVSDLYVDDVLLIDNSTSPLPGELFYGKGSREETNTIHLQEGTTYKIRVE
YASPSASTSFVGPLALSSRGGLRFGGYLKLSPEEHIREAIELAGSVDYVVLVAGLNAEFE
TEGFDRQTLSLPSPTLNLIESILSVRPDAVVCLQSGTPLELPFLDRCDTMLHFFYNGNET
GNGLAEILFGRTNPSGKLPFTIPKKLGDCRSHKTLESFPGVDGKVHYEEGVFVGYRQFVS
HGPQAAFPFGHGLSYTTFQYAQPASAHPSLNLSSTSSIEISCIVRNTGPTQGREIVQLYV
CPPIIEGVDRPKRELKGFKKTSLIPPSGEEKVTLQLNREAFAYWSIANHRWEVQKGIYQV
LLGSSSEDIHGRFDITIEEDFSF

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	48	269	3.1e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.68e-73	40	405	47	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.07e-71	79	855	120	764	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.86e-48	337	715	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.30e-40	79	303	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.53e-40	24	800	56	727	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW26513.1|GH3	1.42e-263	12	863	2	858
QRV85495.1|GH3	3.30e-246	12	863	2	849
QRV99550.1|GH3	3.30e-246	12	863	2	849
BCS12335.1|GH3	5.79e-246	5	859	4	839
BCS00565.1|GH3	5.79e-246	5	859	4	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.41e-196	20	860	5	839	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.67e-193	20	860	5	839	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.00e-138	19	849	3	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.44e-110	25	860	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.19e-101	23	857	56	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	1.14e-232	19	855	4	829	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.14e-232	19	855	4	829	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.23e-232	19	855	4	829	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.44e-232	19	849	4	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.78e-231	19	849	4	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_08307-t42_1-p1.