CAZyme Information: I302_07931-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07931-t42_1-p1
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		75920.87	3.7654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:522373-525159(-)

Full Sequence      

MKSSTTTLTTYALLVLSTIITSVDAAGPHNRFGVGAHRRHHARAAATSTELSTPVQSSEQ
KRDECELGAWKCVGSVLQRCYNDQWNFVTNCTGTDIICSDGLYTTGCVWTWSVEQNDDAN
ESATSSPPFTSSITVTPTASESSASASTASITNANLAVEPTATATADANEDEECEDEDEQ
DDQEDDEDEGEEYCDDEDDGAWDEYYSSATAVVTATPTSAASVVTAAPTSAIGGDLAPSD
DDDEGDDDDEEEECEDDDSDDYDDASPTTTSSASTSATSIIGGQLWAGHGDASSASTHDW
YSWGTQATATTEDWNTWDQATSTSEDWNTWAQATASASASATSSRGHGKGKGHKSSSADW
AASTSPSWDQSGDVSSTTDEWSTATTTNSWDDWSGQATASSAAWGQSGKGSATASASSSA
YSAKPSKGSNHTTGSPSSSYSSAPHYVIYSDYWLFEMPSVDVLSNFNRFILAFWMTDRGA
VDNAQFWEQLDSTTRQQVITDYHNAGIALMVSAFGSTDAPTSNGADPTQTAQALAKWVKD
YGLDGVDIDYEDMPAMNSAQAVAWIVTFQKELRRLLPSPYIISHAPVAPWFTSANDYSDK
AYVAIHEQTGDGIDFYNIQFYNQGSGVYEDCYSLLFDSGNDWPSTSVFEINSSAGLPLDK
IVIGKPLDEGAAANGFIDASLLAKCVSQAQAKGWNAGVMFWEWTTVSPAVPS

Enzyme Prediction     

No EC number prediction in I302_07931-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	1.04e-24	446	622	5	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119363	GH18_CTS3_chitinase	5.19e-13	534	703	104	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119350	GH18_chitinase_D-like	2.33e-12	522	701	90	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119361	GH18_narbonin	5.99e-11	534	657	105	220	Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba.
226000	Chi1	9.69e-10	461	701	55	302	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43533.1|GH18	8.35e-136	11	710	2	576
AFR95478.1|GH18	1.02e-135	11	712	2	630
AUB25287.1|GH18	1.02e-135	11	712	2	630
KGB77976.2|GH18	4.06e-130	11	710	2	621
ADV22450.1|GH18	1.66e-126	11	710	2	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	8.01e-18	492	705	55	264	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
4RL3_A	2.20e-08	468	638	29	202	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q838S2|CHI18_ENTFA	7.84e-07	487	702	98	321	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999729	CS pos: 25-26. Pr: 0.9790

TMHMM  Annotations     

There is no transmembrane helices in I302_07931-t42_1-p1.