CAZyme Information: I302_07903-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07903-t42_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
961		104130.64	8.7724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:455321-458334(+)

Full Sequence      

MPYAEPSPSPMASPVKESPFHFHRKGHHTPPKHIEHIDNGASSSTGPMPGIPRRTSSHSG
SSTPRRGMFDSISKATHAITSQTFPISRPMEGLPRRSPSSSGSSPHMVSGLPPSESSSLG
LKLHPSPVKSPLLHRAVRDSMISNSTADSSPPSTPNDEHSSLPIHIQDHAKNGESSMPFP
AFDPDFKPPPRSSASKGLLSPNSRPTLAGLRRSSAGHVRGGQNSTGSLQITFPPPISHSD
ESSPIIGGSSSMLRPINMIRKKSGEIVKPSLKQRSMSTPDLTRQAHDSPTEETDSPRGFG
EERSKSVRFADASEGDAKALENVVLFLREQKVTAVGKAVDPENSAYTETETENDTDTDFV
QFRTRRNAAAKAADEGNQIQMEGADRIPRKRTDFSPSGRGSLVGEHVMLERIELQSGLGP
LCLRGTAIVRNVSFQKWVAVRFTLDHWQTVSEVSGTHVCHIPAATSGDEGWDRFSFSIKL
DDYKRKLDERQMILCVHYSVEGQDWWDSNDGMNYNFTFKKSPPRRNTRTSLPASLGTNFA
NEEKSTGLPGLRKSNATPPSANINKAFGAPSSGPASWVFPKLSQRMHGQIQTPSRPDSPM
QTPPPNSFKPPAPPSTHAHLTLAKYCAPSPPQSPPKEMSQTMPQITSPDSYDPVDLQRRT
SMNVINGNYATLVAPDMGHERRSSWNGQNNSWDSFAQAMEHQGSPIKSSSGDATPIAHRS
PVVPADEEESTPEHKPLTLKRSTGDLRKLMQDAENSDLGLMTPPSSNLSSPPTPIHTGLP
AVPMSPSPSASTGESSPVETMSNESTPDLASLSIEIDPKKDGKKMLDNSYQEFLDKFCFF
QSPRMTPVDLEPVYSRPSFIPNKGDNSPNGFPFYGTGSNGRNSPRNTPTPTKQYNSAQDA
FGFNSGGGTPRPSNLNAKQQQNQGESLSHLAPGFHASPADTRAWAQQIHSNTASPSLTAA
K

Enzyme Prediction     

No EC number prediction in I302_07903-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	405	515	3.8e-27	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	6.87e-37	404	517	4	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.18e-07	431	516	1	75	Starch/carbohydrate-binding module (family 53).
273167	rad23	6.15e-04	601	686	85	182	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43441.2|CBM21	1.53e-306	1	961	1	948
AFR95423.1|CBM21	6.55e-300	1	961	1	947
AUB25227.1|CBM21	6.55e-300	1	961	1	947
ADV22361.1|CBM21	1.94e-296	1	961	1	947
UOH82357.1|CBM21	1.94e-296	1	961	1	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	4.14e-11	399	514	28	133	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	8.33e-10	405	520	30	137	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UQK1|PPR3C_HUMAN	4.02e-11	387	523	138	263	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q7TMB3|PPR3C_MOUSE	2.31e-10	387	523	138	263	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q6IN01|PPR3B_RAT	9.57e-10	399	517	124	232	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
sp|Q6GQ68|PP3BB_XENLA	1.11e-09	399	514	119	224	Protein phosphatase 1 regulatory subunit 3B-B OS=Xenopus laevis OX=8355 GN=ppp1r3b-b PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	1.33e-09	387	523	138	263	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_07903-t42_1-p1.