CAZyme Information: I302_07894-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07894-t42_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		43728.51	5.2069

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894025:435325-436865(-)

Full Sequence      

MSAQTKTPLSTPKQPLEILLPFPRTSPNSHSLRLLGELVNEILSNEEVYSVTYSPVLCPV
PKDEGGGRKQLFTIKPHWWQTTNGEWDAARPQGQAQLESLSKSVHILSMGLKYIPDIDTE
VRQRSVEKIEKLLKVFFIDPDTRMEPQVRFSQCHPGQDPMRGNDMFVIAIRYLILVDQAL
LLSGDHIDRHLLTQVKEWMTEQVTWMESSEQGLKARQAEKPLWYNVIFASHRQYIDGDAS
STTHASKAFTDWISNHPKSEDAFQESLRHDNRRHRCLFTLESIFLLASLATPTPEKQDVP
DDSKKYLRDCVEYVQTVTKGPIEDPLEDDIRYLARVAWFDRILDSWDGKVQENEEEEPDG
EGWENGWCKRMRMMWGFV

Enzyme Prediction     

No EC number prediction in I302_07894-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	94	319	4.3e-25	0.7956989247311828

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.34e-06	59	218	6	165	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW99552.1|PL38	3.62e-11	35	289	57	336
AEI39535.1|PL38	4.95e-11	66	290	116	348
AGN70569.1|PL38	4.95e-11	66	290	116	348
SQI95021.1|PL38	6.05e-11	66	241	82	256
QGN38632.1|PL38	6.17e-11	66	241	82	256

PDB Hits     

I302_07894-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

I302_07894-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_07894-t42_1-p1.