CAZyme Information: I302_07694-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07694-t42_1-p1
• CAZy Family: GT31
• CAZyme Description: myo-inositol 2-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	KI894024|CGC5	39471.80	6.3150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894024:1718908-1720462(+)

Full Sequence      

MSLQRKLRYAVLGIGRMGSRHAENIAFRAPRAQLVAVCDPRPSSLDWAKSALPSTIKTFD
SSDRCLRESDVDAVLIASETGLHAKLAIDSMNAGKHVLLEKPISIDLETSRQVVQETEKH
PDLKVMVGFSRRFDDSYREVKNMIDKGKLGIPHLIKSATNDQHDPSGFFVSYAAASGGIF
IDCGIHDIDLARWFLLPSTPAVKQVRKVYALGHNIQHPELEKDNDVDNGIGIVEFENNGI
LVVHCNRTMKHGHDCFTEVFGTEGKVIVNGNPQLNRVEIRDAYGVRTESTPTYYERFREA
FVNEVNEFTDVVLDNKPLPVSCVDALESAKIAAALTHSFRTGLPVYFDDAGEPVLA

Enzyme Prediction     

No EC number prediction in I302_07694-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	5	156	9.8e-25	0.38847117794486213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
275173	myo_inos_iolG	1.36e-103	6	345	1	329	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
223745	MviM	1.98e-68	4	345	1	338	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	3.17e-26	7	129	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	4.03e-15	141	345	1	202	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	2.95e-08	6	197	4	192	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPG91011.1|GH0	1.49e-100	6	346	3	336
URX63132.1|GH0	8.51e-100	7	348	4	338
URL57904.1|GH0	7.83e-98	7	346	4	336
BCS38310.1|GH0	2.40e-15	4	195	27	222
BDC49873.1|GH0	2.40e-15	4	195	27	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MKX_A	3.10e-74	4	340	15	346	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4N54_A	1.59e-73	5	340	13	343	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
3CEA_A	4.07e-55	1	342	3	339	Chain A, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
3EZY_A	1.05e-50	7	343	3	323	Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
4HKT_A	1.59e-37	7	338	4	321	Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40332|IOLX_BACSU	3.53e-62	3	348	1	334	scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) OX=224308 GN=iolX PE=1 SV=2
sp|O05389|YRBE_BACSU	5.53e-57	11	345	9	331	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
sp|Q9WYP5|IOLG_THEMA	8.28e-50	7	343	1	321	Myo-inositol 2-dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=iolG PE=1 SV=1
sp|O68965|MI2D_RHIME	3.96e-38	7	338	3	320	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
sp|Q1AV95|IOLG_RUBXD	3.25e-32	6	355	7	338	Inositol 2-dehydrogenase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=iolG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_07694-t42_1-p1.