CAZyme Information: I302_07373-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07373-t42_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KI894024|CGC2	47397.66	3.9626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894024:861610-863378(-)

Full Sequence      

MLTIYLLALLLPTLSLASPVHLTARQDPCASPTDVAQSWLCEHPEIPTAPVDSATIIAGD
SGTVNPSTVQPLPPSVPGTEVAPSAPVGSVPPSSDIPPTGTSLTSAATRTMGVKPTYPAT
SVSAIPLEGPFSASEVPTPATESTIPNSASSVSAVEPTSSAALPSNTPGSSDCSCGYSFS
DKFNSAYYPKSKIIDFSTIPDGTDLATLGLNVSESTIGPASVADPSARCVGTLENVYIAG
GVLNIKVPAGAGGGLTAGEVIFEEELPTGGVFSMEAKIDKTEGTCQSLFTYTTIEGTSDE
LDMEMLGNNIFKPGQNGDQGIGLSNYQPDGAKDGAHAAYPNDPTADFNRYTIGWFSDSNK
FYYNDEELKGPEPHCKYYIPTTGEIGSLTLCLPVNPCSIVINNWSNGDPGFTQGPPAQDN
ILQVRKLEYYYQTEEHSIYPALAPGCSVENACQAS

Enzyme Prediction     

No EC number prediction in I302_07373-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	270	430	1.2e-16	0.7708333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.55e-20	234	430	30	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.89e-11	270	414	34	160	Glycosyl hydrolases family 16.
223021	PHA03247	1.44e-05	22	169	2695	2844	large tegument protein UL36; Provisional
185684	GH16_lichenase	1.58e-05	270	409	69	187	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
223021	PHA03247	8.12e-05	28	169	2717	2859	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45658.2|GH16	6.15e-29	170	453	142	418
AFR97245.2|GH16	8.20e-29	170	453	140	416
AUB27240.1|GH16	8.20e-29	170	453	140	416
KGB76706.2|GH16	8.81e-28	170	453	130	406
UOH83268.1|GH16	4.23e-21	170	420	130	388

PDB Hits     

I302_07373-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

I302_07373-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999739	CS pos: 25-26. Pr: 0.7256

TMHMM  Annotations     

There is no transmembrane helices in I302_07373-t42_1-p1.