CAZyme Information: I302_07128-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07128-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		86894.48	6.7583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894024:213646-217424(+)

Full Sequence      

MPEEHGDIPPPPYQRHATSTSASSHGAGRMIDPYIFTSPTSAILDSSASWSNSRSNGNGK
IELSINIKEDKFPDLTYGITPTVKEYAAEKDARREIPPSNIVVFYLGTEANLIPLRLIAL
KMIKSHSHRVRISTQETHRDTILQFQQRLDGLRGRDGEELEGKLEFYDVLAGPNFSLKSW
ADDPQQMESTLRSFYKSTYLPNSSTGAPFAADLIIAHPDTLAHVHLGELYGIPVHIVSDK
PISPTISIAHPSSNPIQSNAGEGLTNYLSYALVDNLIWQNLGRAIKKNFRQVPLGLELKI
PITNLWDEGILGRPDDWREHIDIAGFVFDDSKGYRPDEGLLGFLKDAGKVIYMGYGAILS
IKGMSTAGEMPSEVFILEDQNASSWLLGNEKVSAVIYDGSGKSTVPATSCSVLLLIWPIS
SFWSNRLFQLGAFPRPIPIEQVSVEFLSVALDEALSSEIKANLKELAGSLSSEDGVQKSV
ESIHRHLPSLNMRCDIAPGHAATFYHPKFCLLLSGVVAGVLAEEGKLEYSDLALNRPKEY
ASTQADSDPIIGGAQAFFMALSNSVKSVRHLFSEKPPSREVDISSQQQYSIYNEQFPLVD
TVTGPGPKPITDFKSGMKEARREMVEGVKDGVKGFVNGPLDPLKRGNLVGGVFGLVGGSL
VTNPLSGAIRSLESTTRGISSELSKPNIYKTRLAPTAASSPADVLRKPRVESSKAESKFV
SGESRKMILNAWRKVRSEESIRKRRMRRDGILRGVDVSSFGRSEGIDIQYIRGGGGENVR
ESKDRERGEVVEG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.32e-13	100	486	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76612.2|GT1	1.54e-154	59	754	51	792
AFR96358.2|GT1	9.50e-154	10	768	4	804
AUB26266.1|GT1	9.50e-154	10	768	4	804
AAW44796.2|GT1	2.13e-151	59	754	52	791
UOH82765.1|GT1	4.38e-144	10	768	4	792

PDB Hits     

I302_07128-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	3.92e-43	94	488	151	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	8.24e-41	96	489	190	612	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.69e-18	96	487	989	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q7S1I0|ATG26_NEUCR	1.05e-16	98	487	1010	1433	Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=apg-12 PE=3 SV=1
sp|Q0CKU4|ATG26_ASPTN	1.33e-16	100	487	899	1315	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_07128-t42_1-p1.