CAZyme Information: I302_07087-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07087-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	KI894024|CGC3	49133.33	6.0579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894024:94215-95839(-)

Full Sequence      

MGFPRISVELYIITFVVICGFSLVQLLRDPTSSRPSLSLLPQPDYSVNGSPPPPAQPENR
HLNQQECLQRYPKLYHEADRARKWFQGKGGISKDMVDQSETDGGNARLVILNNQLYVKGF
YGGINTRTQAAIAAVYGTLLTSPEPLPDVDFVIQTSDAGGGSHPRFVLDREEKQKDLWLM
PDFGFFSWPEPGVGAYSEVRSKTLEFEHSLGLRLNDDLEVLHDSWENKTQKLFWRGSPMV
EVRHDLLRASKDKPWSDVKELNWGAVNQDEDGRKQNNGDLRTPAEHCQYAFLAQVEGWAY
SGRLKYLQQCRSVIVAHPLKYIQHYHHLFNTRDGDPDQNMVEVPLPLEENLSEVMTELVD
PRNVEKARRIADNSWKMMREGYISPAANECYYRYALRAYASAQTFQPSLEGRAVPYESFL
LMGTTHWDPH

Enzyme Prediction     

No EC number prediction in I302_07087-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	221	403	3.3e-17	0.752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	2.42e-28	90	414	24	334	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	3.97e-13	145	405	1	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	1.44e-217	16	430	12	427
QSZ37094.1|GT0	1.44e-67	62	430	79	435
USW51979.1|GT90	7.95e-62	41	427	47	454
BCS30108.1|GT0	2.96e-61	58	421	78	443
BCR90563.1|GT0	9.79e-60	59	422	113	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.28e-08	90	314	79	297	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q29AU6|RUMI_DROPS	5.99e-08	90	414	89	400	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	1.27e-07	110	409	198	478	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2
sp|Q8T045|RUMI_DROME	3.30e-07	90	314	91	309	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q566E5|PLGT3_RAT	2.11e-06	198	409	278	479	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970696	0.029324

TMHMM  Annotations     

Start	End
7	26