CAZyme Information: I302_07046-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_07046-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		63063.10	4.6752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:1913165-1914902(-)

Full Sequence      

MRPVLGSPPPMTGFPKTPSPVSFLASPSRMTWRSGDQTIAEATYQNPRVLRIRGTVPMSF
STEGSLDVNHWRCWLFRVPPTSKESLPTIEFTTTPDTALRFLALNGDFTLINDAPYDFNF
KDNNRRLTISAKPGETSWEVAIIDREIDTNDTVYEGTPNGSFDDSAESMANAFDEYVEGM
CGWGATALSSVTAADRLGSYVMWTSTVRPAGFLGAEAVLMSKLWMNKLWSWDNCINGLAL
VQFSIDLALNQILLPFQRITPEGRLPDSMSRNEILFDYTKPPIYGWTFFKALQLLNPKSS
EAEPIFTSLSESRLVEIHDRVSLFTDFWFVHRKTNASVLPYYSHGNDSGWDNSTAYDYQT
VCVSPDLAAFLVVQCDFLAKLAAHLGRSSLKWSELRDRTRQGLIEELWNEQEGAFMFKDA
FNGSTWTSTTLLQFLPIIAASHLPETIVDRMVNNLDPYLSEWGLATEKLDSKLYEPDGYW
RGPIWAPPTLMLEAGLRAADQHQLADVVCERYIRLCENNGFAENYNARTGEGNRDLSYTW
AASAYLVLRSEQEARKASAV

Enzyme Prediction     

No EC number prediction in I302_07046-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	210	550	2.6e-29	0.39824561403508774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225942	GDB1	9.47e-16	224	546	281	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
395961	Trehalase	0.008	348	532	276	481	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUW83638.1|GH63	1.33e-120	25	557	71	577
QIY69504.1|GH63	1.33e-120	25	557	71	577
ANF32665.1|GH63	5.32e-120	4	550	43	554
UDF14426.1|GH63	2.07e-119	25	559	68	572
QIZ97665.1|GH63	2.83e-119	23	548	61	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	1.51e-09	404	546	273	416	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	8.18e-09	404	546	273	416	Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
6G3N_A	3.34e-07	368	546	258	444	Mycobacterial hydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199],6G3N_B Mycobacterial hydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199]
5OHC_A	1.02e-06	368	546	258	444	Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OHC_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],6Q5T_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199],6Q5T_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199]
5OI1_A	1.02e-06	368	546	258	444	Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI1_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OIW_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OIW_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJ4_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJ4_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5ONZ_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199],5ONZ_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|K5BDL0|GGH_MYCHD	5.24e-06	368	546	256	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000003

TMHMM  Annotations     

There is no transmembrane helices in I302_07046-t42_1-p1.