CAZyme Information: I302_06794-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06794-t42_1-p1
• CAZy Family: GT15
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	KI894023|CGC3	85588.12	4.5781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:1227158-1231303(+)

Full Sequence      

MRTAILLSALGGFLKLTTGQNITQTSSLSFSATPVSTTVPSATVALDTPVPGQGDYPPVQ
YLCEEGTNTTYCPGVLLQDVQLAGIFPDSKPTNGTLNDTLAAFNALGSNVTVGQIETFVE
SNFKGEGLDLEQIPIEGFNQSPAILDNISDPIYKAWTSIVNSYWTLLIRETNQSSLCNGT
CDSSLIPLNHTVVVPGGRYREIYYWDSRWIIEGLLKSELYNYAWNLLQNMMDFIDVYGYI
PNGGRKYYVNRSQPPMFIQMLDAYVKVTGNTTILERALPLASAEMQWWSNNRTFNYTSPF
TGKTLLVAHYAVNNSAPRPEGYVEDYETVTGASPALNASQKAELYSELATGAESGWDYSS
RWCKQPVQNISDNNPALRTLNVKAIIPVDLLSLLSGDHALLANLYDLYANSTGNSTPTTS
NSTQAGNTTDIVQTNSTTSNGNSSTSSPSNSPAFYHRQQAQLFSDAVLDLCWDPAKAWFY
DFNTTSNSRSNVYSPAGSWPLWQNITPNELANNETEALRFVSGARFLLGKYSGIPSVASL
LYTGLNWDFPNSWPPHLHTTIKAFETLGRHHTNATVLSNLTIPFSQVASGQLGLQESELQ
PQPQSTIGNVSLQTQEAQGKPWPLALSIEYANRYLGAAFCSWYSTGGAIEGLLTQLPLSD
LNATGTYTAGQSGVMFEKFNATDTDAAGSGGEYTVQVGFGWTNGVVLWAAGEYGQYLPSP
TCPLIPIIEVNGNGNSSVYSNGTTTNGTGSVSNGTSDGGNATSSLLFAGYKIPREEWKRA
AKEEKKRH

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	86	572	5.4e-108	0.8615071283095723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	3.14e-94	85	714	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.50e-88	76	714	10	545	alpha,alpha-trehalase
224541	TreA	1.65e-52	76	707	61	546	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	6.17e-48	127	707	92	530	alpha,alpha-trehalase TreA.
237326	treA	2.46e-47	64	707	35	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23702.1|GH37	0.0	14	775	13	757
AAW44482.2|GH37|3.2.1.28	0.0	14	775	13	761
KGB76251.2|GH37	0.0	14	775	13	762
AFR96750.2|GH37	0.0	14	775	13	762
AUB26705.1|GH37	0.0	14	775	13	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.17e-50	110	714	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.40e-49	110	714	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.27e-44	74	707	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	2.27e-42	74	707	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	4.23e-40	74	707	52	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	6.39e-89	71	722	54	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	4.46e-77	68	717	43	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	1.06e-74	71	721	33	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	1.62e-72	71	719	33	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q8MMG9|TREA_PIMHY	1.70e-72	54	718	36	576	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000360	0.999604	CS pos: 19-20. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in I302_06794-t42_1-p1.