CAZyme Information: I302_06760-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06760-t42_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	KI894023|CGC1	46987.57	8.7850

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:1123695-1124990(+)

Full Sequence      

MPSSAFDVESGRFKHKRGGSAFTPPSKYGWSWPKKVFKKKITSYLFGITLLLILYAYLSG
TLGTWKRDIGYILRPLWDTPEGGWNYITQYPPPGDLKDAEVRRKWCQLHGWDVRTARDPE
PPKLIDAILFSSELDMLEIRMREYEPYVSKFLIVESNMTFSGQPKRTYFLDNRHEFDFIP
ESKIEYHLITDFEANLPVGSFDNEIKQRTKIGNELRNLANSGEIRKGDMIIQSDVDEIIS
RQTLQLLRTCSSIPSPLHLNVDNYRYTFQFPLNDGGYYRPKIVRYDTIDSLAYNHGRASN
DLLGGSGWHCSFCFATISEIRAKMLGYSHNDRVRHKGLLEPKKLRKTVCEGRDPFDMFPE
AFTFKDFIAQSGRPRKADSFNHVPIALKESPDKFRYLLDGGCERPE

Enzyme Prediction     

No EC number prediction in I302_06760-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	104	399	4.7e-78	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	9.29e-129	35	405	1	349	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ96698.1|GT17	8.76e-97	141	406	1	264
ACR35217.1|GT17	4.15e-84	36	406	10	364
CBD28616.1|GT17	1.08e-82	45	404	53	389
CAF33485.2|GT17	1.08e-82	45	404	53	389
BAF30274.1|GT17	1.31e-82	67	405	40	363

PDB Hits     

I302_06760-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q02527|MGAT3_RAT	9.85e-11	60	406	164	510	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=Mgat3 PE=1 SV=2
sp|Q10470|MGAT3_MOUSE	9.85e-11	60	406	164	510	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Mgat3 PE=1 SV=2
sp|Q09327|MGAT3_HUMAN	1.30e-10	78	405	135	505	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000034

TMHMM  Annotations     

Start	End
43	65