CAZyme Information: I302_06743-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06743-t42_1-p1
• CAZy Family: GH95
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
968	KI894023|CGC13	108784.12	8.7704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:1080110-1084042(-)

Full Sequence      

MSYGYPPPTSQGNRSPAPPYHSQSSPYNQQQTYNDPLDSYYTDFQRAPSPAYGTSNYNQP
AASPSLTGYQQGYQAPATPLDPHAEMYGQPYQQNPPGGDVGVGEVFRPNNQHLLPQRPPQ
QNFYQQNQPQAQSRPSFSSQHSDYYPDETKSYSSTTHLASTPQKEWDVGSVVPSVPRDMG
YNNQNQNQYYPPRPMYNTGPPSSVGSNAGWGGTSHWHKMRNQLLERRVVKQIPLHNGNLI
MDVPVPKGVIPSSSKGLEMMDGEVESLRYSAATCDPDDFMARKFNLRQYLYGRKTELFIV
MTMYNENSELLLRTLNSVIKNIAHLTSRTKSKTWGPDAWKKVVVCIVADGRKVVDPRVLK
VLQLMGVYAEGVMKDHVAGKETQAHIFEYTSQVVVSDTGEVGFGSTPVQLLFCLKEQNKK
KLNSHRWFFNAFGSIIKPNVCVLLDVGTKPSGTSIYELYKCFEKHPNVGGACGEIFADTG
RFGKLLFNPLVAGQNFEYKMSNILDKPFESVFGLISVLPGAFSAYRYDAVKNHADGSGPL
AAYFHGEMMNLPGATASIFDRNKFLAEDRILAFEIVVKKNAKWRLQYVKSAKAGTDVPAR
VPEFISQRRRWLNGSIFAATYAMVCFWRIWTSGHNFFRKIALTFLTVYNLVNLLFNWLSI
SSFYLAFFFLISSSISGNSDPFGGAGDEIFQVFNKVYIGLIFVVLVCSLGNRPQGSNWMY
TFCIFMFAVCQGILLYCAGWTVYQTVPHTTEGWKDVDGLFANKTFLDLAMSLMATYGLYL
ISSLLYFEPWHMLTSFVQYLLLLPSYVNILLIYAMCNLHDVSWGTKGDNGASKDLGSAKK
VEKDGKEMAEVALPTKQEDVEALWQQARAELRVPATEKAEKRSAETKRADQDRNFRTNVV
LLFLGSNMLVILLFTSSAFTTWVNTHFTSATQSTFNPYLTVIFYAVLGLSALRFLGCVLY
LVFRLFGF

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	303	462	4.3e-69	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.07e-95	303	462	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.94e-86	299	618	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.48e-29	231	302	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.57e-28	400	842	104	438	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.60e-16	393	533	30	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR96547.2|GT2	0.0	27	968	18	942
AUB26480.1|GT2	0.0	27	968	18	942
AAW44688.1|GT2	0.0	77	968	75	947
ADV23478.1|GT2	0.0	19	968	14	946
KGB76436.1|GT2	0.0	19	968	14	945

PDB Hits     

I302_06743-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VQ06|CHS2_CRYNH	0.0	27	968	18	942	Chitin synthase 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS2 PE=2 SV=2
sp|P30599|CHS2_USTMA	3.85e-279	159	967	237	1073	Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS2 PE=3 SV=2
sp|Q12632|CHS1_MUCCL	1.92e-240	221	966	96	849	Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus OX=29924 GN=CHS1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	2.63e-239	173	966	48	856	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P87073|CHS1_PHYB8	1.40e-228	220	966	94	839	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
611	630
651	673
688	710
722	744
764	786
899	921
941	963