CAZyme Information: I302_06532-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06532-t42_1-p1
• CAZy Family: GH72
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		34371.91	6.4141

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:514812-516507(+)

Full Sequence      

MSAVKEGDYDGIREQIRGIMKQPGYDDGSAGPVLVRLAWHASGNFSLVEHTGGSNGAGMR
FPPESVDPANAGLHHAISFCLPIQAANPWLSHSDLWTLAGITAIEAMGGPKIPWEPGRTD
YSTAEAAAEHRGDISERLPDGALGADHIREVFGRMGFSDREIVALSGAHALGRCHEDRSG
FEGQWVVNPIRFSNQYYKLLLRDIWKPRKWDGPFQYEATVAGTKLMMLPTDMALVQDPKF
KPWVEKYAADQDLFFKDFSMAFAKLIELGVERDDTGFAQLVKKAAREGKPLDQTAQPSGG
GCPFAGGKKRDAKL

Enzyme Prediction     

No EC number prediction in I302_06532-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	19	270	7.6e-52	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	3.65e-124	8	273	12	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	8.55e-75	29	295	29	266	L-ascorbate peroxidase
166005	PLN02364	3.84e-67	13	269	20	246	L-ascorbate peroxidase 1
178467	PLN02879	5.32e-67	13	269	21	246	L-ascorbate peroxidase
223453	KatG	5.98e-56	3	267	63	414	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB79457.1|AA2	4.15e-194	1	314	1	334
UOH82599.1|AA2	3.30e-189	1	314	1	355
UOP57177.1|AA2	7.74e-124	5	282	3	280
UOP56908.1|AA2	8.01e-124	5	282	3	280
QQK46267.1|AA2	1.34e-112	8	276	5	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	9.08e-73	31	270	43	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
3M23_A	1.33e-71	31	270	40	271	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
2V2E_A	1.45e-71	31	270	43	274	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
5EJT_A	1.45e-71	31	270	43	274	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]
2V23_A	1.54e-71	31	270	45	276	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP56|CCPR2_CRYNJ	1.33e-174	1	314	1	315	Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNE03890 PE=3 SV=1
sp|P0CP57|CCPR2_CRYNB	1.33e-174	1	314	1	315	Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNBE3880 PE=3 SV=1
sp|Q4PD66|CCPR2_USTMA	1.10e-127	5	306	3	304	Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP2 PE=3 SV=1
sp|Q5B1Z0|CCPR2_EMENI	1.01e-116	5	276	3	275	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1
sp|Q4WLG9|CCPR2_ASPFU	4.08e-111	5	274	3	273	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_06532-t42_1-p1.