CAZyme Information: I302_06428-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06428-t42_1-p1
• CAZy Family: GH71
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		95100.75	5.2222

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894023:228138-231103(+)

Full Sequence      

MSFKTNDQMDKSFLTASIPEVIKQMTEEEKISLLAGKDWWNIKVTDGPNGARGESFYHMC
PATALPNATCLGATFSSDLAELSGSLLADETRARNASCLLAPTINIQRSPLGGRAFESFA
EDPTLSGLIAAGYIRGLQDKGVSATIKHFVANDQEHERMGQDSIIAARPLRDIYLRPFQI
AQKHSQPWAFMTAYNKLNGTHCSENPWLLQNILRGEWKFDGLVMSDWYGTYSVSESVNAG
LDLEMPGPAKWRQKDLISHMLYSHKIDPRTLDKRVSEILNWVQKLAKLNEGLVYAKSSKE
KTRLEHQEADAKILRRIGGEGIVLLKNEQGVLPLNKPKSKVGVIGPNAKTKVLTGGGSAM
LRASWSVSPWEGLVNNKPDDVELFYSLGATTSKFLPILGEEFTTLDKKAGFDLRHYAIDK
ETGEMKEDPVVVEQWDTSDMLMGDFYHPDLGDQYCTELSALFTPRESAEWEFESTITGQA
WLWIDEEMIIDNSKYTSKGTAYFGSGSDPAKGTFRAEAGKSYKIRYLHDSRVPSTLINVV
STPLNIVGMRLGAFPKIDPEQSIVEAVELAKTVDVPLIIAGLNADWESEGYDRPDLSLPL
RTNELIARVAEVNPKTVVVIQAGSAVSMPWINQVSGIVYAWYGGNECGNSIADVVYGNIN
PSGRLPLTLPVKEEDIPASLNYKSARTKTYYEEGIWVGYRWYNERKIKPLFPFGHGLSYT
TFEYSNLKITAQSPGGTKADEWKLDVSVDLKNTGEIVGSHSVHFYTCPPEETPTSLKHPE
QTLQAFKKVQDLKPGEKVTVKVTLDKYAISHWDEGWNTFRAELGEWSVKIGKDAETMVGD
ARFVIDEEIEWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	246	3.8e-59	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.55e-67	63	843	118	762	beta-glucosidase BglX.
224389	BglX	4.67e-64	62	359	80	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.55e-50	322	719	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.79e-36	10	805	39	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.93e-34	62	251	85	289	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76680.1|GH3	0.0	6	854	5	863
UOH84802.1|GH3	0.0	6	854	5	863
ADV23736.1|GH3	0.0	6	854	5	863
AGV14847.1|GH3	0.0	6	854	5	863
AUB28992.1|GH3	0.0	6	854	5	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.32e-203	18	854	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.45e-198	18	854	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.33e-124	14	838	1	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.32e-94	22	846	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.02e-90	18	848	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	7.67e-217	18	854	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	7.67e-217	18	854	6	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	8.37e-216	18	854	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.37e-216	18	854	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	8.64e-216	18	854	6	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000002

TMHMM  Annotations     

There is no transmembrane helices in I302_06428-t42_1-p1.