CAZyme Information: I302_06322-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06322-t42_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652		75512.44	6.9966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894022:2115019-2118050(+)

Full Sequence      

MPRLRVTRSSVILTIVGLLFVSFFIFSPGPEYDLNFDDYSDSNEGNGGGIGGVALDKVRS
HQKVINQWLSSTDPSLPQGLEYTKQGYLKGWEKLHESLKSSNLKKKDKKRLQSLIKVHPI
VELMQKGEERWNNLLERQSKTLPQAVTEYRRRYGRAPPKGFDQWWQFCKRNQVKIVDDYD
QIFRDIEPFFALSPEMFNKRVNDLTETQHVAHITLSPDGPSSLFGERKISARPRLLFQLL
EPIAQYLPKEVTFTLSDHDLGSWILGDDQKQAALQAISEGKYLTEAELKALEKREGRQPV
KGLVSACPQGSPGWERGMAIKEGRSTEEWDPQDEQEMSFIYDPLPFYDFCSNPSLLKLHG
SLSFDFCRETVLRPIFQLSKFVRNPEFLTTPLEAYDNFTSAEGRKKYVPWEQKSISKLFW
RGSTTGDSYSKRKDYTWHQSHRPRLALMTQDGQVGEKDIWVKARGRTDGGAWNKESWSIN
RLNAAYMDVGLTGGPHQCKKEDGTCDEMAKEIVFKDRVRPEDAAKYKYVFDIDGNGWSSR
FHRLIMSGSVVVKATIYPEWLSDWMTPWVHYIPCKIDYSDLYDIMAFFAGPPDGRKGGHD
ELAQQIAEQGKKFGEEHWRWEDMQAYMFRLMLEYSRLLADDREDWSYQKTYD

Enzyme Prediction     

No EC number prediction in I302_06322-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	372	638	2.7e-70	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.40e-28	402	638	72	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.32e-16	521	638	211	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ51497.1|GT90	0.0	1	652	1	641
AAV28738.1|GT90	0.0	2	651	3	640
AAS92531.1|GT90	0.0	2	651	3	640
KGB79935.1|GT90	0.0	2	651	3	640
AEG78614.1|GT90	0.0	2	651	3	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.92e-16	479	639	196	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.94e-11	479	638	231	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	9.54e-99	118	644	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.14e-15	479	639	224	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	5.53e-15	479	639	224	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	7.38e-15	479	639	224	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	3.12e-13	479	639	224	371	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000012

TMHMM  Annotations     

Start	End
9	26