CAZyme Information: I302_06013-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_06013-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	KI894022|CGC6	74816.29	8.5017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894022:1273072-1275760(+)

Full Sequence      

MPPRSSRSPAYGVSPKAKWNKSLPTTNHPPSHSSFPLSSVGMIPHSVPRPIRRPKKILYL
MVIFFLLYWFGIRHGLGIERIPPPPLGFAVPGGRRGRRSSLFWGDKGTATLLPPTQGLKP
EHPIYELMEKAETKWTNLLSSQSKTLQQAVSEYKKRYRMPPPLGFDEWFNFCQKNDIKII
DEYDQLMRDLLPHHALPAQTFIARSKALEGTGFTYTLDISKQGVGLVGERSNAARPKHLQ
GLIGGFVDDLPEGFYLKVTGSDHDTGSVVLGKDQRERAMSLVREGNHFDETELKALEDPN
RTPAWGWFKACPLDSPANIRPGAENATDAVLPKSFISDHLPTMDFCEYPELKRLHGAMSL
DYAHRSPSILKPILVLSKFPGDSSFQTTPMEAYMNITESDVPYLGTWEDKTDNRLFWRGS
TTGGYGGQRDWKESHRMRLHLMINGPKGGDTWWNQQLREIMVPDGEGSYKVVRRWERVLS
KAYADVKLSGKPVQCPNADVCQQVADTIEFGERVWPDQAAAFKYNLDVDGNGWSSRFHRL
LSSGSPVIKFTMFPEWHMEWLTPWYHYIPLKPDYSDLYDIMAFFVGPVDEAGNIDSTKGH
DYLAQKIGEAGQKFALEHWSWVNMQAYTFRLLLELQRLHSLDRDMMSYKEPEPRKQG

Enzyme Prediction     

No EC number prediction in I302_06013-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	406	639	1.1e-60	0.74

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.89e-16	522	638	146	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.30e-11	407	638	155	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74886.1|GT90	0.0	6	649	4	634
AAW42911.1|GT90	0.0	39	649	21	634
AAR84596.1|GT90	0.0	39	649	21	634
UOH80885.1|GT90	0.0	2	650	3	635
AUB24727.1|GT90	0.0	2	650	3	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.39e-06	522	640	237	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.01e-85	122	644	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6GZU9|027R_FRG3G	1.76e-08	339	621	196	428	Uncharacterized protein 027R OS=Frog virus 3 (isolate Goorha) OX=654924 GN=FV3-027R PE=4 SV=1
sp|Q7ZVE6|PLGT2_DANRE	4.50e-07	522	650	361	480	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	4.51e-07	523	652	363	483	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.09e-06	522	640	265	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999893	0.000127

TMHMM  Annotations     

Start	End
57	76