CAZyme Information: I302_05940-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_05940-t42_1-p1
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	KI894022|CGC9	49336.57	4.6897

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894022:1086285-1088029(+)

Full Sequence      

MSLSILPYQNRYLRPILLLLLLSTLLYTVPSLYAPTTSRTTLSEDVCGIEDPSSCSDEPI
LPIAKNLQELNINLGDVVSIIQRSIEASGRGYDSEWYKNELGFKVRYESLEGYRSSLSRI
WEMYFHVEDKHGLEGIMKYLSFLPPSSPDEKQGIPKNVYTTSLEDPNKLPEQFNSWTKEN
GDYAVRFVEDDEIDGWIEGMYPSSGLGREMGWLKERSKWGVVRSDLFRYLVLLLNGGIYT
DTDTACVLPVSQWGKNADHHRSTNPLLEALPQLLSLSSSHPDIPDTDDSPSLIIALENDS
PSSGSDWRAETFVRGIQVVQWTIASRKGHPVFLDVVGHALDKVRELREVEERGWEVGDEQ
DILEWSGPGAFTDAVFRYLLIRYGFHPKQASGLDKPLRVGDVLIMPVHSFRADASEGYQG
DEKAVWHGFFGRWKPT

Enzyme Prediction     

No EC number prediction in I302_05940-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	7.09e-08	166	254	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	1.95e-07	167	266	93	191	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74945.2|GT32	6.06e-117	72	434	64	435
AFR94929.2|GT32	2.76e-114	72	434	68	441
AUB24663.1|GT32	2.76e-114	72	434	68	441
AAW42866.2|GT32	9.72e-113	72	434	61	434
ADV21986.1|GT32	8.32e-98	72	434	64	415

PDB Hits     

I302_05940-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.50e-27	149	434	94	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.95e-26	154	434	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.36e-19	164	410	142	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.76e-19	130	434	74	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000555	0.999434	CS pos: 31-32. Pr: 0.9691

TMHMM  Annotations     

Start	End
12	34