CAZyme Information: I302_05615-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_05615-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KI894022|CGC9	41214.53	4.4478

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894022:216305-218169(-)

Full Sequence      

MPLMSDTTTSTARPFASDYARQNIPSEQYYSMSDQPSYGGNGGFTQASPRGGGKRKWWII
GGILGVLALIGIIVGVVVSQVNKNNSSSSSNSGSSQRNGNGTSTIKNEGDPSDFDKDSRL
HQSFWGFAYTPQDALLPWCGASQNNVTRDIQLLSQLTTRLRLYGANCNQSALVLQAIQDT
KVDMTVWLGIYVDSNEEAYEDQVKSVTEALKTYGTDHVSGVTVGNEYILNTAGTDSTTSS
IYLSASKTITDKITEVKAAIAKLGLSKTLPVGTSDAGSVMSKTLGEGIDYFMANVHPWFG
STSIDEAAEWTYNFFQEFDVAPAALASNKPSVYIAETGWPTESMNASESNTGFGGPKGEA
SLANLQTFLDTYVCQANANGTEYF

Enzyme Prediction     

No EC number prediction in I302_05615-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	145	384	3e-17	0.8295819935691319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.34e-22	123	384	44	277	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
225531	COG2984	0.001	188	291	162	263	ABC-type uncharacterized transport system, periplasmic component [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47222.2|GH17	3.68e-159	1	384	72	457
KGB79281.2|GH17	5.58e-159	1	384	72	459
UOH85421.1|GH17	2.16e-156	1	384	54	439
AUB28743.1|GH17	2.88e-156	1	384	73	458
AFR98574.2|GH17	2.88e-156	1	384	73	458

PDB Hits     

I302_05615-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.17e-46	39	384	290	640	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.19e-46	39	384	290	640	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.19e-46	39	384	290	640	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B8NTP7|BTGC_ASPFN	5.57e-46	33	384	279	637	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	5.57e-46	33	384	279	637	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999362	0.000668

TMHMM  Annotations     

Start	End
57	79