CAZyme Information: I302_04412-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_04412-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		45042.43	4.1724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894020:2727427-2729199(-)

Full Sequence      

MRPSTSVLSLLSIIPFLTGRALGSTKSCKAKSTTGTSVIGVAAVATDGTTSAVGALSSLA
SGGTDLPSGTATSAPAGDSSIAAVDAGSSAPTSTAPASAAGNSSSTGTGVNPADPTISSG
SHPTFEFKQPDKEDCKCGYKVSGLDDIYMPFKFQFNFSEIGDAGPFSGPDDLKQYGWRIN
EGHHVGGPSSNGTETDPTTGETKTVPINQCLGDPSSLSVQGGNLHLTMKGGQTPSGEMKC
PEIIHDNATLYGIFQAEMQLDDTPGTCMAFWLNHTVNAENIADELDLEVISGAIMQPSPE
GTAAGLWSTNWDVNGNSSDPLNLEHTTGSDGSSPTPFEIDPTLDFNTYTIAWVPGEYSPR
YLNGKEIGSPSQHNAIHAQEATFNTWSNSASGWSAGPPVDDVTMKVRSVLFYYRTEEVQG
LIDGCSEEDVCKV

Enzyme Prediction     

No EC number prediction in I302_04412-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	224	412	7.4e-18	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.59e-22	221	412	37	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.09e-06	212	354	1	113	Glycosyl hydrolases family 16.
237537	PRK13875	0.002	34	121	277	386	conjugal transfer protein TrbL; Provisional
237211	PRK12798	0.003	40	125	302	398	chemotaxis protein; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45658.2|GH16	4.74e-65	134	433	144	419
AFR97245.2|GH16	3.46e-64	133	433	141	417
AUB27240.1|GH16	3.46e-64	133	433	141	417
KGB76706.2|GH16	1.58e-62	133	433	131	407
UOH83268.1|GH16	1.18e-48	134	401	132	387

PDB Hits     

I302_04412-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

I302_04412-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.930218	0.069797

TMHMM  Annotations     

There is no transmembrane helices in I302_04412-t42_1-p1.