CAZyme Information: I302_04401-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_04401-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		37601.84	4.7686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894020:2693475-2694806(+)

Full Sequence      

MLIHKALFLILPLFANAKPKHCKSKAASSSPTAPLDQALVATGGRGNRWGGRPTSSASAA
TNIPPSSAAASFAQPSSSPAAAASGTPKSGTGVSSSAGGAISSVSPPISTGTGGSGNNTH
SASGNCSCGYILSQYDNAYFPKALIVSFDSVSDISALEGLGLRVQDGSRAGSVAPDGGYC
QASADNVAIDEGVLKLTVPGRQAAGGVITGAEIETTTPVLGGVFTMSAQLSPVHGTCQAI
FTYSADKDASVDEMDIEMVYIEPGLQLTNHDPNGSGENDFEINPFSNDPTAGFSDYTIGW
FKDGPKYYYNGAVLTGPTKYPAVNPSNIVINNWSSGKPTFTQGPPGEDTVMLGMSPPSDI
KMSSSVLMI

Enzyme Prediction     

No EC number prediction in I302_04401-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	186	351	5e-21	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.15e-23	177	351	22	202	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.76e-14	183	343	2	160	Glycosyl hydrolases family 16.
225182	BglS	7.73e-04	219	336	116	239	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45658.2|GH16	3.35e-35	123	367	142	394
AFR97245.2|GH16	4.33e-33	123	348	140	381
AUB27240.1|GH16	4.33e-33	123	348	140	381
UOH83268.1|GH16	8.96e-32	123	354	130	394
KGB76706.2|GH16	1.83e-31	123	349	130	373

PDB Hits     

I302_04401-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33693|EXOK_RHIME	1.40e-06	176	343	58	229	Endo-1,3-1,4-beta-glycanase ExoK OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000965	0.999007	CS pos: 17-18. Pr: 0.9657

TMHMM  Annotations     

There is no transmembrane helices in I302_04401-t42_1-p1.