CAZyme Information: I302_04367-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_04367-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	KI894020|CGC3	51835.95	5.6074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894020:2601643-2603383(-)

Full Sequence      

MNRTDLLSAGAYRRNARTGRVSSWDHSGRNEDAFTVRPGESIVLADVEGPGAITHLWFVQ
GCRKVLGPGVAPYTATNCPFMETHRALGLFDEANDENFYRNVVIKIFWDDQTEPSVLAPL
GDFFCIGQSMPANFSSLPFSVSVRPMDDHKYGGTSALNCYLTMPFNKRATIEVENQGDNT
YIQYFYIDYELYPEPHGKDILYFHAMWKRENPTRGWAPSRMAANSREIQQPKNLDATGDS
NYVILETEGAGNYLGCNHSITHMQGVWWGEGDDIIWIDDDSWPPSLHGTGGEDYFGQGWG
MQKNAYPFCGTIIHEDDITNNQVSYRFHMADPIRFNKRIKVTMETGHANHLRDDWSTTAY
WYQTLPGPKLSLPPPELRIPRKATISTEGISDPDVSAMSEQFKALLDAREERFKDYLKDR
QVWIDRRADDSQERAKRNVEIAKEVRTRWMASLK

Enzyme Prediction     

No EC number prediction in I302_04367-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	99	363	1.2e-76	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	2.05e-95	100	363	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93243.1|GH172	2.27e-227	5	453	6	452
CAK39208.1|GH172	4.10e-227	4	453	5	452
UPK94269.1|GH172	3.81e-224	4	454	9	457
QKD59092.1|GH172	2.45e-223	6	454	12	458
QKX59927.1|GH172	6.77e-222	6	453	9	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	2.54e-150	14	446	15	443	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	4.51e-51	20	363	23	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

I302_04367-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000005

TMHMM  Annotations     

There is no transmembrane helices in I302_04367-t42_1-p1.