CAZyme Information: I302_04363-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_04363-t42_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		51829.10	5.2482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894020:2590866-2592705(-)

Full Sequence      

MSAVRAQGSDLLAAAATKKTARSARVSSWDHSGKNEDAFIVKPGESVALADIEGPGALTH
LWFVQACRRILGPGLIPYTKTGVAMMEVHPALGLAFEDNDPDYYRKVIIKMFWDDQEEPS
VLAPLGDFFCIGNSMPANFESLPFSVSVKPSEILKYGGNAGANCYLTMPFNKRARIEIEN
QGENAYIQYFYIDYELYKDPLPQDTLYFHSMWRRENPTGGWAPAEVQTNSLETQVANLDG
KDNYVILETEGEGNYIGCNQSVTHFQGTWWGEGDDMIFVDDDTWPPSFHGTGGEDYFSQG
WGMQKNAFSFAGSIIHEDDVPNTQVSYRWHLPDPVRFSKKLKVTMESGHGNHLRDDWSTT
AYWYQTLPGPKLSLPPVEKRLVRRPTLPQDDVPAADRGRMTDEQKKMAEQRDQRYEEYLK
DRQVWIDRRAKDSKERAVKNREIAAEIRSRWLAGLGK

Enzyme Prediction     

No EC number prediction in I302_04363-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	104	365	5.8e-78	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	2.87e-110	105	365	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93243.1|GH172	5.20e-255	8	457	4	454
CAK39208.1|GH172	3.12e-253	8	456	4	453
UPK94269.1|GH172	1.25e-251	8	455	8	456
QKX59927.1|GH172	7.03e-246	8	455	6	455
QKD59092.1|GH172	1.88e-242	19	451	20	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	1.53e-157	19	448	15	443	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	6.18e-53	18	365	16	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

I302_04363-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999913	0.000134

TMHMM  Annotations     

There is no transmembrane helices in I302_04363-t42_1-p1.