CAZyme Information: I302_03516-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_03516-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: transglycosylase SLT domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		37516.41	6.8696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894020:352964-354435(+)

Full Sequence      

MLPSTITLVTAILPLLALTSASAHSPHPHHLRHRRISNAVRNIQEGENTPRALVSPRDNA
GHAQAKKVIKKTVKKRGGQQCRPRQAATTSFSAAVPTATSSSAVSSAAAPESSSIDNNQA
WGQPQSSAADNTWTSSAAAAPASTSAAAPTSNNNNWSGSSAGGVLSISDGNCGPSNADAN
SPNGAEGWLNCGLDGAGWTPPMVTADQLIAAELSADGIFAPCGPYIDKFNQYAAQYGVKG
IMLASFAMQESTCNPSATGGNGEAGLMQLASVNCGGAPGGNCYDIDFNIGRAAELFSNLI
QANGGNVLLAIGSYNGWRHGLTIGDATAAASQGQCRAQNNLDYIHQYCNGWMQGKSGYEL
GSYCE

Enzyme Prediction     

No EC number prediction in I302_03516-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396169	SLT	5.03e-09	229	316	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
381604	Slt70-like	3.06e-07	224	316	5	106	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
381606	MLTF-like	7.14e-07	229	333	1	110	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
223812	MltE	1.92e-06	223	316	137	239	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
381594	LT-like	4.49e-06	242	316	3	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KNX49777.2|GH23	1.44e-113	163	363	196	396
ADV24528.1|GH23	5.42e-113	163	363	194	394
UOH84334.1|GH23	2.11e-112	165	363	195	393
AAW46053.1|GH23	6.40e-112	163	363	195	395
AFR97355.1|GH23	3.41e-111	167	363	197	393

PDB Hits     

I302_03516-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

I302_03516-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000522	0.999456	CS pos: 23-24. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in I302_03516-t42_1-p1.