CAZyme Information: I302_03317-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_03317-t42_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881		97812.06	4.9837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:3873921-3876620(-)

Full Sequence      

MTITLTAEIVDVTFEQYPNSLGIGIPCPRISWRYASDAKDWYQTEYEIEIREAEQGTCQT
YTFTSESSVLVPWPAPPLKSRQRVQLGVRARSSNGLWTNRLETEVEAGLLQESDWSNSFV
SSSLIQPADKAKRPYRLRQSFIIQASKIHTARLYITALGVYESYMNGVRIGEDVLSPGWT
SYSARLPYQTYDVSSLVREGSNVLGAWVGEGWYSGVLGYQGGSRNIFGDRPGLLAQLEIN
GEPVQGKWEWSFGAITSSGLYEGEKYDTNLPDCSDLSQGEWQEADILPRPSCRLFSSQSP
PIRVVRAVKPVELITTPSGKIILDFGQNLAGVVRLLCNPPSNSDSQLIIRHAEVLEHGEL
GTRPLRFASATDTIILSDRNITGHFPRFTFHGFRYAEITGWPTISINDVEALVFQSSMDP
SGTFTCSHSLINRLHENAIWSTMANTIAIPSDCPQRDERLGWTGDVCVYSPTMSYLFNSS
GFLSEWLQDLWHDQQKLDGVVPIFIPDTGTDVSTPEAIWGDASVLVPNDVYVSSGDLNVL
ERQFESVKMWLDKGVTRNPSTGLWSGDRDQLGDWLAPRAPPETPNMGPTDNILVADAWLI
HSTRTAGKIAHSIGRLADAATYQKQAEELIEEFYAEYVTRSGRLVSETQTALCLLLHFEI
FPTQRKDILDYRSLFSERLAHLVAKANWLIDTGFAGTPIVLPTLADNGHLSHAYRMLQAT
ECPSWLSPVLLGATTIWERWDSMLADGSINPGEMTSFNHYALGSVASFMHEYVGGLSPLS
PGWKNISIHPRPGGTITSAKTSHQSPYGKIGVEWEIREGVFHMSVEVPPNCTAEVIVPGS
GQRETIGSGLRQYSSQYTLPSFPPPPYIPHFAPVRPNEWAA

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	315	836	6.5e-155	0.9920634920634921
CBM67	130	270	1e-19	0.7670454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.60e-124	422	773	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	3.53e-54	147	306	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	5.49e-28	314	413	1	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	8.97e-24	775	851	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99843.1|GH78	2.86e-264	4	857	12	861
KNX49829.1|GH78	2.84e-263	15	868	13	877
AAW44459.2|GH78	4.47e-261	5	857	1	842
AUB23713.1|GH78	1.19e-259	15	868	13	877
AFR94105.2|GH78	1.19e-259	15	868	13	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.55e-238	8	853	3	863	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	3.04e-150	128	838	296	995	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.64e-112	11	849	34	910	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.14e-149	128	838	296	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	1.75e-127	15	838	42	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	1.74e-124	15	838	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	1.35e-61	12	837	35	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000039

TMHMM  Annotations     

There is no transmembrane helices in I302_03317-t42_1-p1.