CAZyme Information: I302_03026-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_03026-t42_1-p1
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692	KI894019|CGC5	76795.50	4.3522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:3123485-3126510(+)

Full Sequence      

MIPLTLLSSLPLLFLLLSPPTSAQYDADSSGYKLQTPPLTTDWTEKVGTDPWVEYPRPQQ
VREQWQSLNGIWRYQKANSSEDIGIVPRNVGQDWGRAVMVPSCIESGLSGLQVDIKDNEF
SWFQTKFDVPSEWKDQSLLINFGAVDYEATVFVNGKNATTHKGGFTRFDAEISSLVEYGQ
ENEISVFVHDPTDSEEFVVPVGKQTRDPSHIFYTPCSGIWQSVFIEPVPKTYILRIDLSG
DMDGVGTINVHTSDSSEQSVKLSISDSEGTAYETNENTETSFNFTLPNVRLWSPDSPTLY
NVTVTMGDDVVDTYMGFRSIASGVVSGIMRPLLNGEFIFAFGTLDQGYWPDGLYTPPSYE
ALKFDLQFLKEMGFNMVRKHIKVETDLFYRACDELGLLVIQDMPSTTARKDFRPNQEQQA
QFVTELRELVNLHKSFPSIFTWVIYNEGWGQPEDGPEVKHAPMVKDLDPTRLVDATSGWN
DHRAGDYSDNHHYPDPQCGIESVAPPSGKYDAARIGIQGEFGGLSYNVSIDHLWNVPKAI
AEMNQTYEIDETLEEWNTRSRDLLGMLESQVTNYACSGAVWTQTVDVEGEINGLMTYDRR
MERVDKAIWKEAIQNIFSAATDRGAGSGSGSGGNATKTSEDGPSSSSAKAQSNVATSGLS
TNETRKNSRGSQIKLDVNVGALLGLGGILLNL

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	58	497	5.9e-101	0.511968085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	8.95e-41	63	473	10	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	2.04e-40	55	473	3	445	beta-D-glucuronidase; Provisional
236673	ebgA	3.80e-19	117	473	107	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	6.43e-11	66	229	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	4.23e-09	223	318	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD59220.1|GH2	3.91e-255	32	625	35	633
QMW41001.1|GH2	5.54e-255	32	625	35	633
QMW28926.1|GH2	5.54e-255	32	625	35	633
QRD85177.1|GH2	5.54e-255	32	625	35	633
BAE58640.1|GH2	6.41e-255	32	625	49	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	8.96e-110	39	611	12	577	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ECA_A	2.42e-29	66	469	41	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
6ED2_A	5.85e-29	55	447	30	441	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
5C70_A	1.25e-28	67	473	22	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	3.36e-28	67	473	47	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KM09|PLH16_FORAG	2.42e-21	89	478	79	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P26257|BGAL_THETU	5.19e-21	121	471	56	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	8.06e-21	121	453	105	436	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.43e-18	121	442	58	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|Q56307|BGAL_THEMA	1.57e-16	32	473	3	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999735	CS pos: 23-24. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in I302_03026-t42_1-p1.