CAZyme Information: I302_03008-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_03008-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699	KI894019|CGC1	80331.48	6.2418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:3061963-3065227(-)

Full Sequence      

MAFRLPAPRRGIRSLLVLLTLLLVPYLLLRHLSSIRHDEDLPRTNSDLLRNRLEGRNDEL
VLSDETQQLPFGLNRFFDDDDEEDQPIRMGRSKNRYNEDDEGEEDRGRKGKRPISNRAEH
RFLPNGLLIPNIHSPHPIFELISRSKKNWQKKLDGQSKTLSEAVDEYRRRYARNPPRGFE
RWWAYTERNGVGLRDEYDQIYHDLEPFHALPPTKIQSLLKASSEHSGMYTISCPGISSSS
SSNNNNQLSSKCVYKIVETGLNEEGKRVAKERAKAQLGLLEGIEELLEPVKVVMYSHDVP
WQFVGHEYVSESAVFLLHHDAKRSDPFRQIDTAHLGWASACAPHKPLRHDYDPDILPDLD
GLWNGDKSFVWDHKATMDPCTHPTLTHLVGFLSGHGKGPAPSKELYPVLAMCKTTLHADV
LGVSMEAWTEDVGNDPAWEDKKDDRMLWRGKTTGIYFNDEVPWNISQRINLVSHSAEPLG
HIPVFDVPPSYNPNKPVGEPQNLPLSQLNAELMDVAFVDEAIQCDPKICRRVQAGYKFGA
RKDWSQGNQYKYLLDIDGNGWSARFKRLMSTNSAVLKSTIFPEWYTDRIQPWVHYIPIKA
DLTDLYDVLSFFRGHDELAKEIAVEGKRWSKAYWRKEDMIAYQFRLFLEYARLLADDRDA
ASFDTKGVELRKRAEEYREIEEDADVAADKTRGDVVAEQ

Enzyme Prediction     

No EC number prediction in I302_03008-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	402	654	2.7e-62	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.91e-28	405	654	30	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.15e-17	549	654	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW03676.1|GT90	5.61e-153	120	663	117	649
QRV74770.1|GT90	5.61e-153	120	663	117	649
QRV89460.1|GT90	9.89e-151	115	663	112	649
CCA67199.1|GT90	2.22e-143	118	663	88	623
CDR40950.1|GT90	2.12e-115	120	664	146	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	6.81e-15	549	655	236	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.87e-11	549	654	271	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.88e-89	136	686	152	687	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	2.87e-16	549	653	361	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	3.78e-16	549	653	360	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	1.10e-14	549	655	264	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.49e-14	549	653	361	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999921	0.000121

TMHMM  Annotations     

Start	End
12	29