CAZyme Information: I302_02922-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_02922-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		48962.68	6.1135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:2836068-2837706(-)

Full Sequence      

MHVSNLLLPLLTLSVTAPAAVSALHINPHHKKALSTLTTNQQAKRDGSVPSTHKNKVKRL
VKKKKRGTCQVKFNATSVATEPTASSTSAEVLPTLTNNENWANATASATQTWGDNTASAS
ASASASSTSSAGNSQSTSSWSKVEEWSGDSFFDNVNFWEWNDPTHGTVDYLNRGDAWNSG
LISINANKRAVMAVDTTQVVSGGRKSIRIHGNRIYTGGLIIMDAYHMPTGCGTWPAWWSN
GPNWPEGGEIDIFEGVNDFGQNQVSLHTGNGCTMPNNMNDNQVGQLTTGGYDSYNCASYA
TSNQGCGVRDEVTQNAYGESFNAIGGGVYATRWSKAGITVWFFPRTNIPSDITNDSPEPS
GWGKPMAHFPSDNCNPYQFFYDHFNIFDTTLCGDWAGADGVWNYAGYAGQSQSCASKTGY
ATCADYVLNQGSAFAEAFWEVSYVKYFNSTTEV

Enzyme Prediction     

No EC number prediction in I302_02922-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	180	427	6.8e-84	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	4.35e-143	139	448	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	3.02e-10	140	399	1	217	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	4.43e-05	232	269	106	150	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21207.1|GH16_1	4.07e-210	4	453	4	453
AUB23409.1|GH16_1	2.61e-208	1	453	1	452
AFR93831.1|GH16_1	2.61e-208	1	453	1	452
AAW42432.1|GH16_1	1.34e-203	4	453	4	452
UOH80029.1|GH16_1	2.86e-202	24	453	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDU_A	6.39e-75	148	442	11	290	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	6.59e-75	148	442	12	291	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	4.88e-74	148	442	10	289	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	5.19e-74	148	442	12	291	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']
5JVV_A	6.86e-64	139	445	2	295	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	9.72e-75	139	441	128	411	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	3.32e-66	137	445	30	325	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	3.56e-66	144	451	24	318	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A2QBQ3|EGLX_ASPNC	2.49e-65	138	449	25	322	Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g00850 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	1.71e-59	137	445	29	324	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.066290	0.933665	CS pos: 23-24. Pr: 0.8061

TMHMM  Annotations     

There is no transmembrane helices in I302_02922-t42_1-p1.