CAZyme Information: I302_02540-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_02540-t42_1-p1
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	KI894019|CGC13	47888.02	6.0170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:1849716-1851564(-)

Full Sequence      

MSQNINLITPVKELYDPALSVKVVGVAKKYDTDPNGPPPSRTPEYTVPGGPNSYHCSQNA
KAWTQGFFPGTLWLLAERAELDPSSIDPHYSKEDLIKLARRWQADFKYQARPSPNHDQGF
RFQLSYGKDYAMTGDEEAKKVLIDAAESLVDRYNPSAGCIRSWDSMTFVEDGHNYTEEKK
DQHYLVIIDNMMNLDLLYEATKLTGDERYAKVATHQAEKSLISHVRKDYTTYHVANFDQN
TGLPIELRTAQGYANESVWSRGQAWAIYGYGQCALRTGRQDFIDTARKLTDVFISLLGPS
GVPEWDFKAPKPCPYDASAGVITAVGMLWLYKLLLPTDKTAAEGYLNRAVKLVQDTIREC
LTPTATLKENGEVDFGKDGWETLLQHSTIVGNPISKRKIMDHGLVYADYYLVEFSNELLK
IQQGK

Enzyme Prediction     

No EC number prediction in I302_02540-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	58	413	2.8e-94	0.9726443768996961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	8.14e-11	58	269	24	200	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH85098.1|GH88	4.78e-180	14	422	34	439
AUB28341.1|GH88	1.37e-179	14	422	34	439
AFR98229.2|GH88	1.37e-179	14	422	34	439
KGB75742.2|GH88	3.72e-153	9	368	9	366
AUB28342.1|GH88	1.10e-124	14	305	34	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.98e-43	63	423	73	393	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	8.98e-42	47	424	27	367	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	4.69e-41	47	424	27	367	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	3.59e-38	44	413	49	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.66e-38	44	413	50	385	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.07e-51	60	413	74	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	4.62e-41	47	424	27	367	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.88e-37	44	413	50	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	2.52e-37	52	413	57	383	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.29e-34	52	413	60	386	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000055

TMHMM  Annotations     

There is no transmembrane helices in I302_02540-t42_1-p1.